ORFeome > dtx2 – XORFeome 2.0

dtx2 – XORFeome 2.0

General Information

Species: Xenopus tropicalis deltex homolog 2 (Drosophila), mRNA (cDNA clone MGC:69209 IMAGE:5307533), complete cds
Gene Symbol: dtx2
Gene ID: 407940
ORF gb_acc:
ORF ID: 10733

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC067930

Library Location

Plate ID: GDExt11006
Well Location: E11

EST Sequences

Clone: MGC:69209 IMAGE:5307533
Trimmed Sequence: ATGGCAGCTGCTCCTCCACCAGGTGGTGGGGTTCCTAGTTTCTCAGGACTTCCTACGGTGTCTAATCAGTGGAATGCCTCTGTTGCTGTTTGGGAATGGCAAGATGAGCATAACAAATGGCGACCATACAGCAGTGCAGTGAGCAACTATATTGAACAATATATGGTGTCATATTCACAGCAGAAAGGTTTCCGAGCCTATGGAAACAGCAACAGCATATCTCTTGGAAAAGCTGATCCTAAACTGGCACCATACATTATTGATATTCCAACCCTTTCACAGTTTAGGCAAGATACAGGAACCATGCGAAGTGTGAGGAAATCACTTTATGCATCAGATTCTGCACCAGCCAAAGGAATTTCTTGGGAATGGATGAATGATGAAGCATGTTGGACTGCTTATGAAATGCCAATTACCATATACTTAGATGAAAATTACTGCAATAGAAGACCATTGGTGGATCTTGGAGCATTTGGACTCCCCTACCAGGCTGACTTAAACTCTGGCATTCAGATAAATAAAATGACAGGTTTTAGAAGACAAATTCAGAGAAGAGCTGACATTCCTTATCCGTTAACATCAGCAATGGGACCTGTTCATAAATCTGCAGCATGTCTTTGTCACCAGTGCCTAGCCAACAGTGCAGCGGGTCCTATATCTGGACGTCACCGACACTCCATGATAAACTTGCCCACCTCCTCTGGTAGCCAGCTTTCTAGGACTTCATTTGCATCATCCTTTAATGTTGGTTATGTACCCTATCCAAAGCCATCAATGGCCATTTCAAAGTCCACACCAAAACTTAATAGCACTTGGTTAACCTCTCCAGTCCCTCTACAGTTTCCAGGACCATCATCATCATCTAATGGAACCAGCATACCGTCTATCCCAGTAAACACACAGAAGCAAAACTCAACAAAGCAAGCCTTAGCAGGCATGACGGCTATTCTGATGTCTGCAGCTGGGCTCCCAGTGCGCTTTACTTCTGCACCTCCACCTTCCAACCCACCCGTGAACAGTAAACCTGATAAAAATCACAACTCAGTTAGGAAATTGAGGAAAATGCCAAAAAAAGGAACTGCTACTGAGCCTGAGAAAGTTGTAAAGAAATATCTTGAGAACGTAGAAAAGCCACCAGAAGAGGACTGCATAATTTGTATGGAAACACTGAATGTTGCTTCTGGATACAGTGATGCTGTCGAGTGCAAGAACATCAAGCCAACTGCAGTAGGGAAACTTAAGAAGTGCGGCCATACATTTCATCAGCTTTGTGTGCTAGCTATGTATAACAATGGAAACAAGGATGGCAGCTTGCAGTGTCCGGCATGTAAAACAATTTATGGAGAGAAGACTGGAACACAGCCGAAAGGAAATATGGAATACTCTTTAATCCCCCAGTCTTTGCCTGGTCACCAGGATTGTGGCACTATCCATATTGTGTACACCATACATCCAGGAACACAGGGGCCTGGGCACCCCAATCCTGGTAAGCCATACTCAGCCAGAGGCTTTCCACGCCACTGCTACCTTCCAGACAATGAGAAAGGCAGACTGGTACTAGAGCTGCTGAAGCTGGCTTGGGCCAGGCGACTGATTTTTACCATTGGTGTATCCAGCACAACAGGGGAATCTGATACAGTAGTGTGGAATGAAATCCACCACAAGACTGAAATGAACTCTAACATTAGTGGACATGGCTACCCTGACCCTAATTACATGGACAATGTCGTTGCAGAGCTTGCTGCTCAAGGAGTCACTGAAGATTGCTTAAAAATGTGA
Full Trace Sequence: gccagtctttggagctgctgcggcccatgcagaggagggggtaggcgatctgaatgtagaactccggtggctcaggtttcagatgccagaaaggtacatcaatacacaaaagaagggtttgcaagaggtttgtacaatggtgaacgaaaaaggagttgcaacccaaagaaattagttctgaaaaccaagaacagtaaaaaaatattttttggataatacgctcattcctttcagatggcagctgctcctccaccaggtggtggggttcctagtttctcaggacttcctacggtgtctaatcagtggaatgcctctgttgctgtttgggaatggcaagatgagcataacaaatggcgaccatacagcagtgcagtgagcaactatattgaacaatatatggtgtcatattcacagcagaaaggtttccgagcctatggaaacagcaacagcatatctcttggaaaagctgatcctaaactggcaccatacattattgatattccaaccctttcacagtttaggcaagatacaggaaccatgcgaagtgtgaggaaatcactttatgcatcagattctgcaccagccaaaggaatttcttgggaatggatgaatgatgaagcatgttggactgcttatgaaatgccaattaccatatacttagatgaaaattactgcaatagaagaccattggtggatcttggagcatttggactcccctaccaggctgacttaaactctggcattcagataaataaaatgacaggttttagaagacaaattcagagaagagctgacattccttatccgttaacatcagcaatgggacctgttcataaatctgcagcatgtctttgtcaccagtgcctagccaacagtgcagcgggtcctatatctggacgtcaccgacactccatgataaacttgcccacctcctctggtagccagctttctaggacttcatttgcatcatcctttaatgttggttatgtaccctatccaaagccatcaatggccatttcaaagtccacaccaaaacttaatagcacttggttaacctctccagtccctctacagtttccaggaccatcatcatcatctaatggaaccagcataccgtctatcccagtaaacacacagaagcaaaactcaacaaagcaagccttagcaggcatgacggctattctgatgtctgcagctgggctcccagtgcgctttacttctgcacctccaccttccaacccacccgtgaacagtaaacctgataaaaatcacaactcagttaggaaattgaggaaaatgccaaaaaaaggaactgctactgagcctgagaaagttgtaaagaaatatcttgagaacgtagaaaagccaccagaagaggactgcataatttgtatggaaacactgaatgttgcttctggatacagtgatgctgtcgagtgcaagaacatcaagccaactgcagtagggaaacttaagaagtgcggccatacatttcatcagctttgtgtgctagctatgtataacaatggaaacaaggatggcagcttgcagtgtccggcatgtaaaacaatttatggagagaagactggaacacagccgaaaggaaatatggaatactctttaatcccccagtctttgcctggtcaccaggattgtggcactatccatattgtgtacaccatacatccaggaacacaggggcctgggcaccccaatcctggtaagccatactcagccagaggctttccacgccactgctaccttccagacaatgagaaaggcagactggtactagagctgctgaagctggcttgggccaggcgactgatttttaccattggtgtatccagcacaacaggggaatctgatacagtagtgtggaatgaaatccaccacaagactgaaatgaactctaacattagtggacatggctaccctgaccctaattacatggacaatgtcgttgcagagcttgctgctcaaggagtcactgaagattgcttaaaaatgtgaccaagttgttccactggctgccttttgctgtcttttaggggagcattcagttaattgaggccttaaagtttaactatagttttcctatttcagtagagcaatatgtctttaagaggtttacaaataagctgaggaagtctgccttgttttgtacatgactgacatgctggttcatatcaccatccctgcaggacagggtttagtcagtatggactctccatcatgttcatccctgtacacgcatgagagtgaaaggatttttcaagacaagtttcatggcggtcttaaccatatggcaagcaaactagcatgtttccaatacataattagctaattctccaatatattggtaagctgataaggcagcgaatgaaccaaatctcatattctttagtaacaacatactggttattattaaattgtgtaaaaccccaaacttaaaaaaaaaaaaaaaaaa
Translation: MAAAPPPGGGVPSFSGLPTVSNQWNASVAVWEWQDEHNKWRPYSSAVSNYIEQYMVSYSQQKGFRAYGNSNSISLGKADPKLAPYIIDIPTLSQFRQDTGTMRSVRKSLYASDSAPAKGISWEWMNDEACWTAYEMPITIYLDENYCNRRPLVDLGAFGLPYQADLNSGIQINKMTGFRRQIQRRADIPYPLTSAMGPVHKSAACLCHQCLANSAAGPISGRHRHSMINLPTSSGSQLSRTSFASSFNVGYVPYPKPSMAISKSTPKLNSTWLTSPVPLQFPGPSSSSNGTSIPSIPVNTQKQNSTKQALAGMTAILMSAAGLPVRFTSAPPPSNPPVNSKPDKNHNSVRKLRKMPKKGTATEPEKVVKKYLENVEKPPEEDCIICMETLNVASGYSDAVECKNIKPTAVGKLKKCGHTFHQLCVLAMYNNGNKDGSLQCPACKTIYGEKTGTQPKGNMEYSLIPQSLPGHQDCGTIHIVYTIHPGTQGPGHPNPGKPYSARGFPRHCYLPDNEKGRLVLELLKLAWARRLIFTIGVSSTTGESDTVVWNEIHHKTEMNSNISGHGYPDPNYMDNVVAELAAQGVTEDCLKM
Donor tissue: gastrula