ORFeome > efhd1 – XORFeome 2.0

efhd1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis EF-hand domain family, member D1, mRNA (cDNA clone MGC:76180 IMAGE:5335733), complete cds
Gene Symbol: efhd1
Gene ID: 394919
ORF gb_acc: MG132705
ORF ID: 9996

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC063917

Library Location

Plate ID: GDExt11001
Well Location: D11

EST Sequences

Clone: MGC:76180 IMAGE:5335733
Trimmed Sequence: ATGGCAGAGACAGAGCTAGCCCAGAAGCTCCAACGCCGCCTGGTTCTGGAAGATAGCGACCCCCCGGCGGACGGAGCTGAGGGGCAGCAGCCGAGCAATGAGCAGCACAACGGGGAAGAGAAAGAGGCCACTTCCAGCGCCGACTCCGAACTGAGTGCCAAACTGAACCGGAGACAGGACATCAACGCGGGCAACGCCGTGCCAGCCAACCGGGGCAAGGTCTTTAACCCTTACACCGAGTTCAAGGAGTTCTCCCGAAAGCAGATCAAGGACATGGAGGCAATGTTCAAAAAGTATGATTCTGGGAAAGATGGCTTTATTGATATGATGGAGCTGAAGTTCTTGATGGAGAAGCTGGGAGCCCCACAAACTCATCTTGGGCTGAAGAACATGATAAAGGAAGTGGATGAAGATTTTGATAACAAGCTGAATTTCCGGGAGTTCCTACTGATCTTTCACAAAGCAGCAGCTGGGGAGCTGGAGGAGGACAGCGGCTTGCTGGCTCTGGCTAAACTCTCAGAGATCGATGTGGACGTTGAGGGAGTGAAGGGCGCCAAGAACTTCTTTGAGGCCAAGGTCCAGGCTCTTTCCTCCTCCAGCAAGTTTGAAGCAGAGATCCGTGCAGAGCAGGAAGAGAGGAAACGACAGGAAGAAGAGAAGAAAAACCGCAGAGCTGCCTTTAAAGAACTGAAGTCTGCGTTTAATCAGTAA
Full Trace Sequence: ggcagcctctccctgtccggagcccccgcagccatggcagagacagagctagcccagaagctccaacgccgcctggttctggaagatagcgaccccccggcggacggagctgaggggcagcagccgagcaatgagcagcacaacggggaagagaaagaggccacttccagcgccgactccgaactgagtgccaaactgaaccggagacaggacatcaacgcgggcaacgccgtgccagccaaccggggcaaggtctttaacccttacaccgagttcaaggagttctcccgaaagcagatcaaggacatggaggcaatgttcaaaaagtatgattctgggaaagatggctttattgatatgatggagctgaagttcttgatggagaagctgggagccccacaaactcatcttgggctgaagaacatgataaaggaagtggatgaagattttgataacaagctgaatttccgggagttcctactgatctttcacaaagcagcagctggggagctggaggaggacagcggcttgctggctctggctaaactctcagagatcgatgtggacgttgagggagtgaagggcgccaagaacttctttgaggccaaggtccaggctctttcctcctccagcaagtttgaagcagagatccgtgcagagcaggaagagaggaaacgacaggaagaagagaagaaaaaccgcagagctgcctttaaagaactgaagtctgcgtttaatcagtaactgaccattcagcgagacagtgcttgcataggcttctcccagctctgcacttctcaaccataattcaatgcgagaggcacttaagccctttgtattgccttataaggggggataacattgaagctaatcctgttaaatgcagaaaatgatcttctgtctaatctttaatacaagggacctacatttggcctagccacatttctctttttttgagagagagatttggttatattgcagttttgtataccacatcaccaactgttatgttattttttctcttaagtaagtgctttttctgccgcaccacaagagataatgagtttatttgtactaactgcaggataaaactattccagtgtaaattcctccctagggccactacagctgcaagaatcataggcaaccgttttcctttagttcttggtttcagccctgttccaggtctgctgaaaagtagttgcacaaacaattgagtatgggatttgtttcttctctcaggcattacaggttgatggcaaaacaaagcatatttgtatacatgtacattgattggccaagcacggatccatcagaattcctcaatcattcctgcatataaacctgcattccagcaaattgggggctgagatagcatattttaaagcataaaggctgataaccattccatatatgacagaaatcacagttccaggaccattgattgcacctgtcgtatcacttgccctgccctatcagggattggggcgccctgctatttttttttaaaaggcaaggtttcccatttcttatgccgtaaatgtctatagcagtgcttcttcttcaattatgcttgggaaacggaatcaaataaagggacagaatctatagtaatattcttttaggcagattacatacttttaaagatgagctatttttaacgctgaaagactactggcatctgattggcatgagctgcaaactataatttcccattagacaaggtctgatgtcaccattaaatgcttgaactatgtttttttttaaatattgtcagattgtattagctgtacataacctgaaagaggatatttaaaagacgagcatatatattctttggttagggactgaggaatgtgtttatttctgaaactaacctacagtcctatataaatattcagtcctttatgtgatattggttagggagggatttcatgataaatgcttatcaggctaaaataaatgttctgtacattaggtctaatggccacaagctgtaataacatcgctcaaagccataaagatttttgggcgcttattcaggatcagctttacaactgaggtagcttatgttctaaatgtctgtacctaagaacaaggcagctggaattcatgaacagagatgctgaagttgatcctagctccccaacacatgagtgtttaacagggtcagacccaatcctccctgggaagcattggtgctcccctgctgacctgcctcccctgattgtgaagaggtaaaagtatgaggggttggcccctgggatggcagccctggtgggtaccgcacacctcagtctgacactggtgttttaggatcttgtgcaactgcaaggtgagacccagggcccaatgcatcattctctctgctagtttgcccattgcactagtatggaccatttagaatatacccaacagctctaaagttggtactgaattccaagcctgtactgtgagcttgttcaaccattggcataaaaagtcaggggggagccaaattaatgtgaatcattgctttagcctctgcatagactgaagagcttgctccggcaatgaattgatcttggtacttaagatgttaataattgttttatgagttctatttctttgtgtgactggagggggccaaccagcacaataacagtgttccagtgctctgtgacttccagcattgtgctaattaccttctgttctccatacattttatattaatattggaaaataaatgttttactaataaaaaaaaaaaaaaaa
Translation: MAETELAQKLQRRLVLEDSDPPADGAEGQQPSNEQHNGEEKEATSSADSELSAKLNRRQDINAGNAVPANRGKVFNPYTEFKEFSRKQIKDMEAMFKKYDSGKDGFIDMMELKFLMEKLGAPQTHLGLKNMIKEVDEDFDNKLNFREFLLIFHKAAAGELEEDSGLLALAKLSEIDVDVEGVKGAKNFFEAKVQALSSSSKFEAEIRAEQEERKRQEEEKKNRRAAFKELKSAFNQ
Donor tissue: tailbud