ORFeome > eif3-p48 – XORFeome 2.0

eif3-p48 – XORFeome 2.0

General Information

Species: Xenopus tropicalis eukaryotic translation initiation factor 3, subunit 6, mRNA (cDNA clone MGC:76151 IMAGE:5335300), complete cds
Gene Symbol: eif3-p48
Gene ID: 394752
ORF gb_acc: MG132704
ORF ID: 9995

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061611

Library Location

Plate ID: GDExt11001
Well Location: D10

EST Sequences

Clone: MGC:76151 IMAGE:5335300
Trimmed Sequence: ATGGCGGAGTACGACTTAACCACGAAGATCGCCCACTTCTTGGACCGGCATTTGGTCTTCCCTCTCCTTGAATTTCTATCCGTCAAAGAGATTTACAATGAGAAGGAGTTATTTCAGGGGAAGCTGGACCTCCTCAGTGATACCAACATGGTTGACTTTGCCATGGACGTATACAAGAACCTATATGCAGATAAAGAAATCCCTCACGCTCTGAGGGAAAAGAGGACCACAGTTGTTGCCCAACTGAAGCAGCTGCAGGCAGAAACTGAGCCCATTGTTAAAATGTTTGAGGATCCCGAGACCACTCGCCAGATGCAGTCCACCAGAGATGGCCGAATGCTGTTTGATCACCTCGCTGAAAAACATGGGTTTCGACAGGAATACTTGGATACTCTTTACAGATATGCAAAGTTTCAGTATGAATGTGGCAACTATTCTGGAGCTGCGGAGTACTTGTACTTTTTCAGAGTGCTGGTTCCATCTACAGACAGAAATGCCCTCAGTTCTCTCTGGGGTAAGTTAGCGTCGGAGATTTTGATGCAGAATTGGGATGCAGCCATGGAAGATCTCACAAGGCTAAAAGAAACGATAGACAATAATACTGTCAGTTCTCCACTCCAGTCTCTTCAGCACAGAACATGGCTAATACATTGGTCTCTGTTTGTATTCTTCAACCACCCAAAAGGAAGAGACAACATCATTGACTTGTTCCTCTACCAGCCTCAATACCTGAATGCCATTCAGACTATGTGTCCGCACATTCTCCGATATCTGACGACTGCCGTGATCACCAACAAAGATGTGAGGAAACGAAGACAAGTCTTAAAAGATTTGGTTAAGGTCATCCAACAGGAATCCTACACTTACAAAGACCCGATTACTGAGTTTGTGGAATGCTTATATGTCAACTTTGACTTTGATGGAGCACAGAAAAAGTTAAGAGAATGCGAATCGGTGCTGGTAAATGACTTCTTCCTTGTGGCCTGCCTAGAAGACTTCATTGAAAATGCCAGACTCTTTATATTTGAGACTTTCTGTCGCATCCATCAGTGTATAAGCATCAGCATGTTGGCTGACAAACTGAATATGACTCCGGAAGAAGCTGAAAGGTGGATTGTCAACTTAATTCGTAATGCAAGACTGGACGCCAAGATAGATTCCAAACTGGGTCACGTGGTTATGGGAAACAATGCCGTCTCTCCTTATCAGCAAGTGATTGAAAAGACAAAGAGCCTTGCATTCCGTAGCCAAATGCTGGCTATGAATATTGAGAAGAAAACGAACCAGAACAGCAGAACTGAGGCACCTACCTGGGCAGCTCAGGATTCCGGATTCTATTGA
Full Trace Sequence: cgccggctctagcaatggcggagtacgacttaaccacgaagatcgcccacttcttggaccggcatttggtcttccctctccttgaatttctatccgtcaaagagatttacaatgagaaggagttatttcaggggaagctggacctcctcagtgataccaacatggttgactttgccatggacgtatacaagaacctatatgcagataaagaaatccctcacgctctgagggaaaagaggaccacagttgttgcccaactgaagcagctgcaggcagaaactgagcccattgttaaaatgtttgaggatcccgagaccactcgccagatgcagtccaccagagatggccgaatgctgtttgatcacctcgctgaaaaacatgggtttcgacaggaatacttggatactctttacagatatgcaaagtttcagtatgaatgtggcaactattctggagctgcggagtacttgtactttttcagagtgctggttccatctacagacagaaatgccctcagttctctctggggtaagttagcgtcggagattttgatgcagaattgggatgcagccatggaagatctcacaaggctaaaagaaacgatagacaataatactgtcagttctccactccagtctcttcagcacagaacatggctaatacattggtctctgtttgtattcttcaaccacccaaaaggaagagacaacatcattgacttgttcctctaccagcctcaatacctgaatgccattcagactatgtgtccgcacattctccgatatctgacgactgccgtgatcaccaacaaagatgtgaggaaacgaagacaagtcttaaaagatttggttaaggtcatccaacaggaatcctacacttacaaagacccgattactgagtttgtggaatgcttatatgtcaactttgactttgatggagcacagaaaaagttaagagaatgcgaatcggtgctggtaaatgacttcttccttgtggcctgcctagaagacttcattgaaaatgccagactctttatatttgagactttctgtcgcatccatcagtgtataagcatcagcatgttggctgacaaactgaatatgactccggaagaagctgaaaggtggattgtcaacttaattcgtaatgcaagactggacgccaagatagattccaaactgggtcacgtggttatgggaaacaatgccgtctctccttatcagcaagtgattgaaaagacaaagagccttgcattccgtagccaaatgctggctatgaatattgagaagaaaacgaaccagaacagcagaactgaggcacctacctgggcagctcaggattccggattctattgatgacttcatttgaacttcacaccagctcaaagtttccctgttacccatgctttcttttcctcttacaaaaaccaagccacattgtaaggttaaaggaaggcatgcgtttgaataaaatgggtacacttccttttaaaaaaaaaaaaaaaa
Translation: MAEYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNEKELFQGKLDLLSDTNMVDFAMDVYKNLYADKEIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDHLAEKHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPSTDRNALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNTVSSPLQSLQHRTWLIHWSLFVFFNHPKGRDNIIDLFLYQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISISMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLAFRSQMLAMNIEKKTNQNSRTEAPTWAAQDSGFY
Donor tissue: tailbud