ORFeome > eif6 – XORFeome 2.0

eif6 – XORFeome 2.0

General Information

Species: Xenopus tropicalis eukaryotic translation initiation factor 6, mRNA (cDNA clone MGC:89760 IMAGE:7027465), complete cds
Gene Symbol: eif6
Gene ID: 448711
ORF gb_acc: MG133170
ORF ID: 10624

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC077665

Library Location

Plate ID: GDExt11006
Well Location: D01

EST Sequences

Clone: MGC:89760 IMAGE:7027465
Trimmed Sequence: ATGGCAGTCCGTGCATCTTTTGAGAACAACAATGAAATTGGCTGTTTTGCCAAGCTTACCAACACCTACTGCCTGGTGGCCATTGGGGGATCGGAGAACTTCTACAGTGTGTTTGAAGGAGAACTTTCCGAGACAATACCTGTTGTACATGCATCTATCGCTGGCTGTAGAATAATCGGGAGGATGTGCGTTGGCAACAGACACGGCCTCATGGTTCCAAACAACACAACAGATCAAGAACTTCAGCACATCAGAAACAGCTTACCAGACTCGGTGCGAATTCAGAGAGTAGAGGAGCGCCTCTCTGCCTTGGGCAATGTTATTGCATGTAATGACTACGTGGCTCTTGTGCATCCTGATCTTGACAGGGAGACAGAAGAGATCTTGGCAGACGTCCTTAAAGTTGAGGTTTTTAGACAGACAATAGCCGATCAAGTACTTGTAGGGAGTTACTGTGCCTTCAGTAACCAAGGAGGCCTGCTGCATCCCAAAACATCTATTGAGGATCAAGATGAACTGTCTTCTCTGCTACAGGTCCCTCTTGTGACGGGAACTGTAAACCGCGGCAGTGAAGTGATCGCTGCAGGAATGGTTGTGAATGACTGGTCAGCGTTTTGCGGCTTGGATACCACAAGTACAGAATTGTCCGTTATAGAAAGTGTATTTAAACTGAGCGACGCACATCCTAGTACTATTGCCACCAGCATGAGAGACTCCCTCATTGACAGTTTAACATAA
Full Trace Sequence: ggagaggagcctgtaacttcgggattgtgtgtaacgcacgaggttcggggccgggagttgccgggagttgtctggcttggctgtttgcgggatcgtgcatcagtgatttctaagaagcagacatggcagtccgtgcatcttttgagaacaacaatgaaattggctgttttgccaagcttaccaacacctactgcctggtggccattgggggatcggagaacttctacagtgtgtttgaaggagaactttccgagacaatacctgttgtacatgcatctatcgctggctgtagaataatcgggaggatgtgcgttggcaacagacacggcctcatggttccaaacaacacaacagatcaagaacttcagcacatcagaaacagcttaccagactcggtgcgaattcagagagtagaggagcgcctctctgccttgggcaatgttattgcatgtaatgactacgtggctcttgtgcatcctgatcttgacagggagacagaagagatcttggcagacgtccttaaagttgaggtttttagacagacaatagccgatcaagtacttgtagggagttactgtgccttcagtaaccaaggaggcctgctgcatcccaaaacatctattgaggatcaagatgaactgtcttctctgctacaggtccctcttgtgacgggaactgtaaaccgcggcagtgaagtgatcgctgcaggaatggttgtgaatgactggtcagcgttttgcggcttggataccacaagtacagaattgtccgttatagaaagtgtatttaaactgagcgacgcacatcctagtactattgccaccagcatgagagactccctcattgacagtttaacataaaaaaatggcaagcatccctgatcgttcctttgctcaaacaaacaactctgtcgcttaccagctttttcaccaaactggacttcccaagagcgctgtcgcccaaatatgtctttgttattctgtcatcgcattaaaactgtatctgaaataaaaatgaaatggctttttttaactgcaatttgtgacggggaaaaagagtgtcgtgtaagcatctgcttgctatattgcacttaaatatattctaggttattatgaataataaacagttttattactcgaaaaaaaaaaaaaaaa
Translation: MAVRASFENNNEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSETIPVVHASIAGCRIIGRMCVGNRHGLMVPNNTTDQELQHIRNSLPDSVRIQRVEERLSALGNVIACNDYVALVHPDLDRETEEILADVLKVEVFRQTIADQVLVGSYCAFSNQGGLLHPKTSIEDQDELSSLLQVPLVTGTVNRGSEVIAAGMVVNDWSAFCGLDTTSTELSVIESVFKLSDAHPSTIATSMRDSLIDSLT
Donor tissue: