ORFeome > elof1 – XORFeome 2.0

elof1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis elongation factor 1 homolog (ELF1, S. cerevisiae), mRNA (cDNA clone MGC:75802 IMAGE:5382249), complete cds
Gene Symbol: elof1
Gene ID: 394607
ORF gb_acc: MG132903
ORF ID: 10268

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061318

Library Location

Plate ID: GDExt11003
Well Location: B12

EST Sequences

Clone: MGC:75802 IMAGE:5382249
Trimmed Sequence: ATGGGACGCAGGAAGTCAAAGAGAAAGCCTCCACCCAAGAAGAAGATGACTGGGAACCTTGACACCCAGTTCACATGTCCATTCTGTAACCACGAGAAGTCCTGTGATGTTAAAATGGATCGATCGCGCAATACGGGTGTCATTTCGTGTACGGTGTGCCTGGAGGAGTTCCAGACTCCAATAACCTATCTTTCTGAGCCTGTAGATGTTTACAGTGATTGGATTGACGCCTGTGAAGCTGCTAACCAGTAG
Full Trace Sequence: taagcattgaggcgcagtgagaagaagattgcggattaccaggcgggaaatagctttgattcatacgtagaatccagaggcagagatgggacgcaggaagtcaaagagaaagcctccacccaagaagaagatgactgggaaccttgacacccagttcacatgtccattctgtaaccacgagaagtcctgtgatgttaaaatggatcgatcgcgcaatacgggtgtcatttcgtgtacggtgtgcctggaggagttccagactccaataacctatctttctgagcctgtagatgtttacagtgattggattgacgcctgtgaagctgctaaccagtagcaggactcctttcttgctgccacctagcccagcatacttgtggctgccagcggtttattcatgcatacacctcttgagaggtggacactagccattgtgtttcatacgtgacattggggaatatggaattggccaccactgacctttgcattttgacaccaagggaccacagctgctaaaaccagttatatagatggggatgtatttgtctttttaccttgaagaatatcatccatgtataagtctagccaagcactcagcagaatggtataccatttccccatctctgatgacttattttcatcttgcgtgtacttgcaaaatgattggtcatctctcccaaagtatgcagcatggcagctcctctctcctatgtttaaatgcacattttcagatgaggcatgtcctgtctgtctaaaaatacattatatttgaattaaacggtagcacataaaagcattaggcatagggcgttgtttatcagaatactaaaggagttttttccattagaaaagtttagtgtgtgtaagagtaaacactatgtattgcattctatggtcttttgaccagggaaaggttaatagtctattctattacacctctctgtaaaatgcgggtggatattaaatgataaagctgcctgcaaacagttacttcattgccattggctgctgggcttttagtgttttaagtagaacggtgcttaggaaggtcgaaaacccattggagagctcacgaaattaagaaagtgtaattggtataaatgatgtacaggttttaaaacaatcaagtaactatccatgctccctctctcagcagtctgtctctttctgttatttacatgaaatggagattacattgttaaaagttcccctttatgtgctgaaagtaaaaaaaaaaaaaaaagtgtttttattttatttcattgaataattgagagatcggtttggaaatccggcaagtagaatattttttttttttttcatcccttaaccacttttccagcacattttgtattttttttttttctcactgccaaaagtacagtaaaggtgagacagctgcagagtggggtctgtctgagctaaatcataaagaaaatcataaccaatgatactgatttttcccccaagtatagtaatttccctaataccattttttttttgtaaataattagtaggattttgttctagatactttggaaaattggaagcaaatctttattctgttactaatggatgaaaaagtgttattttttattaaacacaaaattgcgtgaccttcaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MGRRKSKRKPPPKKKMTGNLDTQFTCPFCNHEKSCDVKMDRSRNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAANQ
Donor tissue: neurula