ORFeome > elovl7 – XORFeome 2.0

elovl7 – XORFeome 2.0

General Information

Species: Xenopus tropicalis ELOVL family member 7, elongation of long chain fatty acids, mRNA (cDNA clone MGC:69521 IMAGE:5336518), complete cds
Gene Symbol: elovl7
Gene ID: 448054
ORF gb_acc: MG133386
ORF ID: 10893

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC074576

Library Location

Plate ID: GDExt11009
Well Location: B01

EST Sequences

Clone: MGC:69521 IMAGE:5336518
Trimmed Sequence: ATGGCCTTCAAGGAACTCACATCACAGGCAGTGCTCCTGTATGATGAATGGATTAAAGATGCTGATCCTAGGGTTGAAGACTGGCCCCTCATGTCCACTCCTATCCCACAAACCATCATCATCGGCGCTTACATCTACTTTGTCACATCATTGGGCCCCAGGATCATGGAGAATAGGAAGCCGTTTGCTCTGAAGGAGATCATGGCATGCTATAACTTGTTCATGGTTCTGTTCTCTCTGTACATGTGCTATGAGTTTCTCATGTCGGGCTGGGCTGCTGGATATTCCTATAGATGTGACATTGTCGACTACTCTCAGTCACCTCAGGCGTTAAGGATGGCTTGGACCTGCTGGCTATTCTATTTTTCAAAGTTCATTGAATTATTAGACACTGTCTTCTTTGTGTTACGTAAGAAAAACAGCCAGATCACATTCCTGCATGTCTATCATCACTCCATCATGCCTTGGACGTGGTGGTTTGGAGTCAAGTTCGCTGCAGGTGGTTTGGGCACATTCCATGCACTGGTGAACTGTGTGGTTCATGTTATCATGTACAGCTACTACGGGCTGTCAGCCTTGGGGCCTGCCTACCAGAAGTACCTGTGGTGGAAAAAGTACATGACGTCTATCCAACTGACCCAGTTCCTCATGGTTACTTTTCACATCGGCCAGTTTTTCTTCATGGAGAACTGCCCGTACCAGTATCCCATCTTCTTGTATGTCATTTGGCTGTACGGGTTTGTTTTCTTACTCCTGTTCCTCAACTTCTGGTTCCACGCTTACACCAAAGGGCAAAGGCTGCCGAAAAACTTGCAAAATGGTCACTGCAAGAACAATAACCAAGAAAACGCCCAGTGTAAGAACCAGAGAAACGGTGCATTGAAGAACAAAGAACATTGA
Full Trace Sequence: gcgctgtgtggggggcacaggggtagcgcttggcagagcacatccagactgcagtcaacatggccttcaaggaactcacatcacaggcagtgctcctgtatgatgaatggattaaagatgctgatcctagggttgaagactggcccctcatgtccactcctatcccacaaaccatcatcatcggcgcttacatctactttgtcacatcattgggccccaggatcatggagaataggaagccgtttgctctgaaggagatcatggcatgctataacttgttcatggttctgttctctctgtacatgtgctatgagtttctcatgtcgggctgggctgctggatattcctatagatgtgacattgtcgactactctcagtcacctcaggcgttaaggatggcttggacctgctggctattctatttttcaaagttcattgaattattagacactgtcttctttgtgttacgtaagaaaaacagccagatcacattcctgcatgtctatcatcactccatcatgccttggacgtggtggtttggagtcaagttcgctgcaggtggtttgggcacattccatgcactggtgaactgtgtggttcatgttatcatgtacagctactacgggctgtcagccttggggcctgcctaccagaagtacctgtggtggaaaaagtacatgacgtctatccaactgacccagttcctcatggttacttttcacatcggccagtttttcttcatggagaactgcccgtaccagtatcccatcttcttgtatgtcatttggctgtacgggtttgttttcttactcctgttcctcaacttctggttccacgcttacaccaaagggcaaaggctgccgaaaaacttgcaaaatggtcactgcaagaacaataaccaagaaaacgcccagtgtaagaaccagagaaacggtgcattgaagaacaaagaacattgaccgtacgaataagctcagagatgtctagccgtatcccacagtagtattacttgacaatcaagcatactgggggtagtagtcaactgtacatatttttccaaactagtcagaaccctggatttttactctaagttattggggtttatatgctgtagagaacatggacctgtggggagttggccaacaaatgtacatatatttaactaaaataataagacaactgttttgttacctgaaaagctagcaggcttgtagacttatcaacacatgggtgtgcatgaaaagtaccattactttgaacaccgtgatgaatattaacgagacaatgtaataaaaggttcagaatttgccccaggtcttgtaactcgtagcaaccaaccagatctttgctctcttcactccctgctaattggttgttatgagttactagacctagagctaaagctgtacctgttatgaaattccccctaaatgttttgttaatgtaatgaataaagtcacacaacaaacttggatctttcaagatatgaactgttttgtaaaagcatctgctacgtttgctgtagaatggctacttgcctgcagttttgtaccggtcgtgccaaaataaaatgaaaaccttttgcctaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MAFKELTSQAVLLYDEWIKDADPRVEDWPLMSTPIPQTIIIGAYIYFVTSLGPRIMENRKPFALKEIMACYNLFMVLFSLYMCYEFLMSGWAAGYSYRCDIVDYSQSPQALRMAWTCWLFYFSKFIELLDTVFFVLRKKNSQITFLHVYHHSIMPWTWWFGVKFAAGGLGTFHALVNCVVHVIMYSYYGLSALGPAYQKYLWWKKYMTSIQLTQFLMVTFHIGQFFFMENCPYQYPIFLYVIWLYGFVFLLLFLNFWFHAYTKGQRLPKNLQNGHCKNNNQENAQCKNQRNGALKNKEH
Donor tissue: tailbud