ORFeome > fancl – XORFeome 2.0

fancl – XORFeome 2.0

General Information

Species: Xenopus tropicalis Fanconi anemia, complementation group L, mRNA (cDNA clone MGC:79472 IMAGE:6976304), complete cds
Gene Symbol: fancl
Gene ID: 493212
ORF gb_acc: MG133554
ORF ID: 11085

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC079922

Library Location

Plate ID: GDExt11010
Well Location: F12

EST Sequences

Clone: MGC:79472 IMAGE:6976304
Trimmed Sequence: ATGCTGCGCCAGTGCCCTACTCTCATACCTCAGGATCTGCAAGGGAGGGTGTACGATGGATTCCTCAGTGTACAAGATAAGGATTTTCGTCTCAGGGTCATTTTGCCTGAAGATTTACAGCTGGGAAATGCAAAAATAGAGTGCAGCTGGAAATTAAAGAAAGTTCTGCAAGCTTATGATCAGATTGTGAAGCAGAGGCTACAACATAGCATAAACCTCGAAAGCTTCATGATGGAGCTAAAGACCATCTTGGAAGTGGCTTTGAAGAATACTAATGCATTGCAGACACCTCCAGCTCCCCAGTATTATTCCTGCCTTGTGAAAGACATTGAAAGCCTTGGCTGGGATAAATTGTCATTTGTGGATACTGAATTGAGTATGATCCAGATAAAAATTGAGGATACATCTGGACGTGATCATTTAGTCACGCTAAAACTCAATGCTAAGTACCCTTTTGAAGCTCCTGATTGCTGTGTTGACTTTCCAATTCCTTTTACTATATCCTGGACACCACAGAGTTCTCTGCTGAACGTTTACAAGCAAGTCTCATCAGCACTAGAGTCATTGAAAGGTTTTTGGGATGCTTTAGATGAAATAGACCAAAAGACCTGGGTATTGGAACCAGAAAAGCCCCTGCGCAGTTCCACTATGAGACGGATTGTGATTGGTAATAATGTTTCCATTACAATAGATTTGGACCCTAAGCATCCAACAATGCTTCCAGAATGCTATTTCCTTGGAGCTGAGCACGTGGTGAATCCATTAAGAGAAAAACTGAACTCAAACATTCACTTATGGGATCCAGAAAACAGCTTACTGCAAAATTTGAAAGATGTCTTGGAAATTGAATTTCCATCACGTTCCAGTGTCGAGAAATCTGATTTCAGCATGGATTGTGGCATATGTTATGCCTATCGACTTGACTCTGCCATACCAGATCAAGTGTGCGATGACCCCCGGTGTGGGCAGCCTTTTCATCAAGCCTGCTTATACGAGTGGCTTAGAGGCCTGCCCTCCAGTAGACAAAGCTTCAACATTATATACGGTGAATGTCCTTACTGTAACAAGCCTATTACCCTAAAGATGTCAAACAAGAAACCTTGA
Full Trace Sequence: tgcgctgagaggaagttgctgggactctgtttcatgggaactggttacagtgagtcaggcttaaggcgataccactgtgtcggtggggggaatgctgcgccagtgccctactctcatacctcaggatctgcaagggagggtgtacgatggattcctcagtgtacaagataaggattttcgtctcagggtcattttgcctgaagatttacagctgggaaatgcaaaaatagagtgcagctggaaattaaagaaagttctgcaagcttatgatcagattgtgaagcagaggctacaacatagcataaacctcgaaagcttcatgatggagctaaagaccatcttggaagtggctttgaagaatactaatgcattgcagacacctccagctccccagtattattcctgccttgtgaaagacattgaaagccttggctgggataaattgtcatttgtggatactgaattgagtatgatccagataaaaattgaggatacatctggacgtgatcatttagtcacgctaaaactcaatgctaagtacccttttgaagctcctgattgctgtgttgactttccaattccttttactatatcctggacaccacagagttctctgctgaacgtttacaagcaagtctcatcagcactagagtcattgaaaggtttttgggatgctttagatgaaatagaccaaaagacctgggtattggaaccagaaaagcccctgcgcagttccactatgagacggattgtgattggtaataatgtttccattacaatagatttggaccctaagcatccaacaatgcttccagaatgctatttccttggagctgagcacgtggtgaatccattaagagaaaaactgaactcaaacattcacttatgggatccagaaaacagcttactgcaaaatttgaaagatgtcttggaaattgaatttccatcacgttccagtgtcgagaaatctgatttcagcatggattgtggcatatgttatgcctatcgacttgactctgccataccagatcaagtgtgcgatgacccccggtgtgggcagccttttcatcaagcctgcttatacgagtggcttagaggcctgccctccagtagacaaagcttcaacattatatacggtgaatgtccttactgtaacaagcctattaccctaaagatgtcaaacaagaaaccttgacacattcagaagatagacaaaatgatttcagaaacccgctgaatccatcagagcccatacaatgcaatgtaaatcattagcaaaaatagaggaatggccacgccatatttatacaggtctctgcaatactggggactcatttcacaatgatgatcagaggtagaaacgtgttgaaaaagtgaattttcgtagttgtttggaaaagtttcttcttcatcctctgcagaatacatgtagctctgtagactccttgacatttccatgtcctgtgcaaaataagtatggcagtagtctccttctcctgagcagcactagcagtacaaaagagattgtccttgtaagcagtggcaaatagtcaaaacattgtctgtgtaaatgagaagaaccaaaccctaataacgaatatgtatagaaaggctgtattttatatactgaacttactgcaccagcctgaaatttcagcatctctgtaacagtaatgattcaggcttttacagttgggcacaggggtcaccattgtggatttagctgggagtgtctgtgacgctgcacatgctctgagcagctgcagagaagctgagcttagggggttgtcacaaatcttaaagcagaaaatcaggtttagatgtgatataagctgatgctacagggctgattattaaattcaaatgctaattgcactggtttccaagctgccatgtaatgagaatctgaattactgatatattgtgacatgtatattttatatatacagtatattgtgagtgggcccctaacctcagtaactgacagcagcacagagcatgtgcagggaatcagcagaaaagaagatggggagctactggggcacctttggggcacagatcttccctgctaaagggccgtggttgctttgggctggtacagaacccaaaacataatgtgcaacatttctgccctgctttgaagctttagttgcccctctaagtgtgcacttaaaggagtggttcacctttacattaatttttagtatgttacaggatttctagcaactgtgcaactggtcttcatttttttaaatcatttttgaattttttgccttcctcttctacatttttcagctttcaatggaggtcagtggccccagctctgtgatattacaatgttattattgatactgtttcttattttctattcactcctattcactcctatttatattccagtctctcctatttatatttcattgcctggttgctaaggtaaacatggccctggcaaccagctgccagaattccaaactggagatctgctgaatgaaaagctaaataactcaacagaatataaaaaaaaatgaaaatctactgcaaattgtctctgaatatccctgtctgtgtcatactaagatgtaaattaaaggttaacaacccctttaacgtcccttggctcttaacacaaatattaaccggacatagcagtcaatatagaagccttttcctacaccacttagggatgctgaagtaagaatatccatagattacaaaataaaaaacttccaaatgataaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MLRQCPTLIPQDLQGRVYDGFLSVQDKDFRLRVILPEDLQLGNAKIECSWKLKKVLQAYDQIVKQRLQHSINLESFMMELKTILEVALKNTNALQTPPAPQYYSCLVKDIESLGWDKLSFVDTELSMIQIKIEDTSGRDHLVTLKLNAKYPFEAPDCCVDFPIPFTISWTPQSSLLNVYKQVSSALESLKGFWDALDEIDQKTWVLEPEKPLRSSTMRRIVIGNNVSITIDLDPKHPTMLPECYFLGAEHVVNPLREKLNSNIHLWDPENSLLQNLKDVLEIEFPSRSSVEKSDFSMDCGICYAYRLDSAIPDQVCDDPRCGQPFHQACLYEWLRGLPSSRQSFNIIYGECPYCNKPITLKMSNKKP
Donor tissue: tailbud