ORFeome > fgf7 – XORFeome 2.0

fgf7 – XORFeome 2.0

General Information

Species: Xenopus tropicalis fibroblast growth factor 7 (keratinocyte growth factor), mRNA (cDNA clone MGC:97658 IMAGE:6980824), complete cds
Gene Symbol: fgf7
Gene ID: 496833
ORF gb_acc: MG134399
ORF ID: 12091

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC088532

Library Location

Plate ID: GDExt11021
Well Location: E02

EST Sequences

Clone: MGC:97658 IMAGE:6980824
Trimmed Sequence: ATGCGCAAATGGATGCTAACTTGGATCCTTCCAACTTTGCTCTACAGACCATATCTTCACATAATATTCATTCTGGGCACTGTGTCTCTAGCCTGCAATGACATGACTCCAGAGCAAATGGCTATAAACGTGAATTGCTCCAGCCCAGAAAGACATACCAGAAGTTATGATTATATGGAGGGAGGGGATGTAAGAATAAGGAAACTTTTTTGTCGAACGCAATGGTATCTGTGGATTGATAAAAGAGGCAATGTGAAGGGAACACAGGACCCAAACAACAGCTTCAGTATCTTGGAAATTAGAACAGTGGCAGTCGGAATCGTGGCAATAAAATGCATTGAAAGTGAATATTTTTTAGCTATGAACAAATCTGGAAGACTTTACGGAAAGAAATCATGCAATGAAGACTGCAATTTTAGAGAATTAATCCAAGAGAACAAATATAACACATATGCATCAGCAAAGTGGACAAATAATGGGAAAGAAATGTTTGTTGCCTTGAACAGCAAAGGTTCACCAATGAAAGGAAAGAAATCCAAGAAGGAACACAAAGGATCCCACTTCCTTCCGCTGTCAACATCCTAA
Full Trace Sequence: tcgaaaaccattgaacaacaacaggctcaacacacacagaaaacccctcttgcgtgttgatttatggaaacaattaggattgtgctggagtttttctgagttgagaaatagtttgtcgctacagaatctcatgttgcaaagagcaggcaggagaaatggaatacgtgtatattcagctgttatctgcaggaacaattctgttacttttgcatctaacagcgagtccgtgcagtcctgaacactacaactgccgatgtcacaatatcctgatactctgaagggaactgtgttgagaaacagttgagaagtccaggttttatggcttacacagaagacaagaatacaagcctggaagtgtcttgagtcaggaatttgcatcaacagcacagacttcattcaggtcctggacctagaaacactaatccatctgagatttacgtttcattatgatgtccatgaacacccagagcagtgcactataatgcgcaaatggatgctaacttggatccttccaactttgctctacagaccatatcttcacataatattcattctgggcactgtgtctctagcctgcaatgacatgactccagagcaaatggctataaacgtgaattgctccagcccagaaagacataccagaagttatgattatatggagggaggggatgtaagaataaggaaacttttttgtcgaacgcaatggtatctgtggattgataaaagaggcaatgtgaagggaacacaggacccaaacaacagcttcagtatcttggaaattagaacagtggcagtcggaatcgtggcaataaaatgcattgaaagtgaatattttttagctatgaacaaatctggaagactttacggaaagaaatcatgcaatgaagactgcaattttagagaattaatccaagagaacaaatataacacatatgcatcagcaaagtggacaaataatgggaaagaaatgtttgttgccttgaacagcaaaggttcaccaatgaaaggaaagaaatccaagaaggaacacaaaggatcccacttccttccgctgtcaacatcctaaccataaccctgatactggttccagcagattatttttattttattaatattaataataatgctaataataaaaagtggaaaaggacacaaatataagctggatctactactgaaacaaacaagctggacttgcgcatttcaaaagactgtggtcaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MRKWMLTWILPTLLYRPYLHIIFILGTVSLACNDMTPEQMAINVNCSSPERHTRSYDYMEGGDVRIRKLFCRTQWYLWIDKRGNVKGTQDPNNSFSILEIRTVAVGIVAIKCIESEYFLAMNKSGRLYGKKSCNEDCNFRELIQENKYNTYASAKWTNNGKEMFVALNSKGSPMKGKKSKKEHKGSHFLPLSTS
Donor tissue: tailbud