ORFeome > fkbp6 – XORFeome 2.0

fkbp6 – XORFeome 2.0

General Information

Species: Xenopus tropicalis FK506 binding protein 6, mRNA (cDNA clone MGC:75868 IMAGE:5382919), complete cds
Gene Symbol: fkbp6
Gene ID: 394649
ORF gb_acc: MG133029
ORF ID: 10419

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC061340

Library Location

Plate ID: GDExt11004
Well Location: A07

EST Sequences

Clone: MGC:75868 IMAGE:5382919
Trimmed Sequence: ATGATGTCTGTATTTCATCAGCTGGCACAGCAAATGGAAGATGTATCTGGAGACAGAGGGGTGCTGAAAGAAGTGATTCGGCCCGGAAAAGGAGGGAAGGTTCCCTGTGATGCAACAGTAATACTCAAGTACTCTGGTTACTTGGAACATGCTGACAAACCATTTGACACAAGTTGCTACAGACGTCACCCCAAAATGATGAAGTTAGGTGAAGATATCACCCTTTCTGGAATGGAGATTGGACTGCTGACAATGCAGCGTGGAGAGTTATCAAGGTTTCTCTTCTCACCGAAATATGCCTATGGCACACTGGGCTGTTCTCCTCTCATCCCACCCTCAGCCACTGTCCTTTTTGAAATAGAGTTGTTGGACTTCCTAGACACCGCAGAATCCGATTTGTTTTGCGCCCTGAGTCCGGAAGTGCAGGCAACATTTTCTCTGGATAAGATTATTAAAATTGCCGGAACAGAAAGAGAGTTTGGGAATTACCTTTTCAAGAGAAACAGATTTTATGATGCTAGAGACAGGTACAAACGGGCATCCTCAGTGCTGTCTTGCAAAGCTTCGTGTGAAGAAGAAAGGAAGCTGTTGGAAGCAGCTCAGTTGTTTGTAGCACTGAATCTATCACTTACCTACCTAAAGTTGGAGCGCCCCTCTCGTGCACTGAAATGGGGTGAGAAGGCTCTTTCTATAGATAACAGGAACACAAAAGCTTTGTTTCGATGTGGACAGGCATGTCTGGAGATGAGGGAGTATGACAAGGCTCGTAACTACCTGTTAAAAGCTCAGTGGTTGGAACCCTATAATCCTGAAATAAACAATGAACTGAAGAGGCTTTCAAGTTGTTACCAGGATTACATGGATAAAGAGCGGGAGATGTGCTTCCTGATGTTTCGTTCACTGTCCATGCGACATTGA
Full Trace Sequence: cttcagagccgctaacatacagctcacgttgattggtgagacgcctgtcacatgaccaggcccgcccaaagagcaagtctgagaaaagaccgcgggggaagaaacatgatgtctgtatttcatcagctggcacagcaaatggaagatgtatctggagacagaggggtgctgaaagaagtgattcggcccggaaaaggagggaaggttccctgtgatgcaacagtaatactcaagtactctggttacttggaacatgctgacaaaccatttgacacaagttgctacagacgtcaccccaaaatgatgaagttaggtgaagatatcaccctttctggaatggagattggactgctgacaatgcagcgtggagagttatcaaggtttctcttctcaccgaaatatgcctatggcacactgggctgttctcctctcatcccaccctcagccactgtcctttttgaaatagagttgttggacttcctagacaccgcagaatccgatttgttttgcgccctgagtccggaagtgcaggcaacattttctctggataagattattaaaattgccggaacagaaagagagtttgggaattaccttttcaagagaaacagattttatgatgctagagacaggtacaaacgggcatcctcagtgctgtcttgcaaagcttcgtgtgaagaagaaaggaagctgttggaagcagctcagttgtttgtagcactgaatctatcacttacctacctaaagttggagcgcccctctcgtgcactgaaatggggtgagaaggctctttctatagataacaggaacacaaaagctttgtttcgatgtggacaggcatgtctggagatgagggagtatgacaaggctcgtaactacctgttaaaagctcagtggttggaaccctataatcctgaaataaacaatgaactgaagaggctttcaagttgttaccaggattacatggataaagagcgggagatgtgcttcctgatgtttcgttcactgtccatgcgacattgatggctccatgttccatgctataatgaaggaaaaagcttcattggtaaagaacaggactttgcttgtcaggaaacaaggagacaactacctgaagacaccattgcagtttgtggattatatatatatgctgaggtttcctataaacctaagttcaagtttttgggtttttttttccttatagagccattgttagttaattctgtttataatatataccaaactgatctttataacttaatatcgcataacattttacatccttttcttgttttgcatttacaccatacacgggggatcttttagtgatttctggggttttggggtttttttgtaagttttgatagaataacaaatctttgtctttgtttattttctaatggtcagtgcgggcttgtgaccctagatgcagctgcaagagctccagctgttgcaccccgaagccccattaagcaggaattgaggttcaccaatgatattactatcatgctaaccctgtatgtcactggctctatctcagtaatgtattgagctacatgtgaaccagttgcaatgatttcttgtagtttgggattgttcggttttctaatgattgctctatgctcataatagggcacctgtcttctgtaaagcattgttaatgtttacatcaaaaaaaaaaaaaaagaaaaaaaaaaaaaaa
Translation: MMSVFHQLAQQMEDVSGDRGVLKEVIRPGKGGKVPCDATVILKYSGYLEHADKPFDTSCYRRHPKMMKLGEDITLSGMEIGLLTMQRGELSRFLFSPKYAYGTLGCSPLIPPSATVLFEIELLDFLDTAESDLFCALSPEVQATFSLDKIIKIAGTEREFGNYLFKRNRFYDARDRYKRASSVLSCKASCEEERKLLEAAQLFVALNLSLTYLKLERPSRALKWGEKALSIDNRNTKALFRCGQACLEMREYDKARNYLLKAQWLEPYNPEINNELKRLSSCYQDYMDKEREMCFLMFRSLSMRH
Donor tissue: neurula