ORFeome > foxi4.2 – XORFeome 2.0

foxi4.2 – XORFeome 2.0

General Information

Species: Xenopus tropicalis forkhead box I4, gene 2, mRNA (cDNA clone MGC:76222 IMAGE:5336445), complete cds
Gene Symbol: foxi4.2
Gene ID: 394878
ORF gb_acc: MG132816
ORF ID: 10162

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064241

Library Location

Plate ID: GDExt11002
Well Location: F05

EST Sequences

Clone: MGC:76222 IMAGE:5336445
Trimmed Sequence: ATGAACCCAGTCCAGCAACCTGCCCAGCAGCGCTCCCCTGCCTCCAGCCTGCCTCACCCCAAACGGGCCCAGGAGGCCCCGGACATGGCACTTTATTGTGACAACTTCATGTACCCCCAGCAGAGCCTGCACCCCAGCCAGAGGGGGCCCAACTTCGCCATCGGGGAATACACCTCTCCGGCTAATCCTTACTTATGGCTGGGGGGCCATGGGGTGAACAATGCACCCAATTACAGCCCTTCCCCGGCGCCTTACATGCCCCCGTCCTTTGGCGCCCCCCAGCGGCAGTTCCTGCCCAACTCCCCCGCCTTTGGCGGCACTGAGCTGAGCTGGATGTCGGCGGCTTCCCAGGAGGAACTTCTGAAAATGGTGAGACCCCCGTACTCCTACTCTGCCCTCATCGCCATGGCCATCCAGCATGCCAGCGATAGGAGGCTGACCCTGAGCCAGATCTACCAGTATGTGGCAGAAAACTTCCCTTTCTACAAAAAGAGCAAAGCAGGCTGGCAGAACTCCATCCGGCACAACCTGTCCCTCAATGACTGCTTCAAGAAGGTGCCAAGGGATGAGAATGATCCAGGAAAAGGAAACTACTGGACTCTGGACCCCAACTGCGAGAAGATGTTCGACAATGGCAATTTCCGTCGGAAGAGAAAGCCCAAGTCTGACGCCAACAGCGCTAAAATCGCCAAGATCGGAGAGGATCACTTGAACCCAAAAGGCAAAGAGAGCCCACCCATGATTACTCCCTCCTCCCCCGAGGAGCCGTCTCCCACAGGCCATAGCAAGAGCCCATCTCCCCCAGCGGTCACCTATACCCCCTGTCTGACCAACTTCATCGGCAGCATGACCGCCGTGGATGCAGCTACAGCCAACAGACAGGGCCCCCTGGGGCTCCTCAATGAACTGTCTCAGAGGAACATCAGCAGCTTGAGCAGCTTCATCTCGGGCTCCGCAGTGGATCAGAGTGCAGAGCATCCGGACACCTCCCTGTTCTATAACAGAAGCCCCTATTACAGTTCCTTCCCCACCACTGCCCAGAAGCAGCCGCAGTTCCTTCAGCAGCCCCCTTTGTACCAGGGAAGGTACTGA
Full Trace Sequence: gttggacaagtatcgcaggatgaacccagtccagcaacctgcccagcagcgctcccctgcctccagcctgcctcaccccaaacgggcccaggaggccccggacatggcactttattgtgacaacttcatgtacccccagcagagcctgcaccccagccagagggggcccaacttcgccatcggggaatacacctctccggctaatccttacttatggctggggggccatggggtgaacaatgcacccaattacagcccttccccggcgccttacatgcccccgtcctttggcgccccccagcggcagttcctgcccaactcccccgcctttggcggcactgagctgagctggatgtcggcggcttcccaggaggaacttctgaaaatggtgagacccccgtactcctactctgccctcatcgccatggccatccagcatgccagcgataggaggctgaccctgagccagatctaccagtatgtggcagaaaacttccctttctacaaaaagagcaaagcaggctggcagaactccatccggcacaacctgtccctcaatgactgcttcaagaaggtgccaagggatgagaatgatccaggaaaaggaaactactggactctggaccccaactgcgagaagatgttcgacaatggcaatttccgtcggaagagaaagcccaagtctgacgccaacagcgctaaaatcgccaagatcggagaggatcacttgaacccaaaaggcaaagagagcccacccatgattactccctcctcccccgaggagccgtctcccacaggccatagcaagagcccatctcccccagcggtcacctataccccctgtctgaccaacttcatcggcagcatgaccgccgtggatgcagctacagccaacagacagggccccctggggctcctcaatgaactgtctcagaggaacatcagcagcttgagcagcttcatctcgggctccgcagtggatcagagtgcagagcatccggacacctccctgttctataacagaagcccctattacagttccttccccaccactgcccagaagcagccgcagttccttcagcagccccctttgtaccagggaaggtactgaagcggagttggaagtgacatttgtaggaaaagactgggggatacgtggggggtccaggactgaaatctcccgcgcaagggactaccctaaactgcaaatactatcatccatagctggctgaggatgctgggaaatgtagttcacaagtttagggaataaggagttttttttttcttgaaagtttattttgtataatggtggctgctagagcatgctgggagttgtatgccagcaaatggtacaaagccagactcttcttatctctgttataagacaaaggaatgagcaatattttgcattgtgtaacctgtatatatatgttgtgacttgggtgtcacatggttctttatttatatttttatttaataaaaaagaaaaacatgaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MNPVQQPAQQRSPASSLPHPKRAQEAPDMALYCDNFMYPQQSLHPSQRGPNFAIGEYTSPANPYLWLGGHGVNNAPNYSPSPAPYMPPSFGAPQRQFLPNSPAFGGTELSWMSAASQEELLKMVRPPYSYSALIAMAIQHASDRRLTLSQIYQYVAENFPFYKKSKAGWQNSIRHNLSLNDCFKKVPRDENDPGKGNYWTLDPNCEKMFDNGNFRRKRKPKSDANSAKIAKIGEDHLNPKGKESPPMITPSSPEEPSPTGHSKSPSPPAVTYTPCLTNFIGSMTAVDAATANRQGPLGLLNELSQRNISSLSSFISGSAVDQSAEHPDTSLFYNRSPYYSSFPTTAQKQPQFLQQPPLYQGRY
Donor tissue: tailbud