ORFeome > fst – XORFeome 2.0

fst – XORFeome 2.0

General Information

Species: Xenopus tropicalis follistatin, mRNA (cDNA clone MGC:79635 IMAGE:6980032), complete cds
Gene Symbol: fst
Gene ID: 493419
ORF gb_acc: MG133595
ORF ID: 11132

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC080943

Library Location

Plate ID: GDExt11011
Well Location: G10

EST Sequences

Clone: MGC:79635 IMAGE:6980032
Trimmed Sequence: ATGTTAAATGAAAGGATCCAGCCGGGCATGATTTTCCTCCTGACTGTCTCTCTGTGCCATTTCATGGAACATCGCGCAGTCCAAGCTGGGAATTGCTGGCTGCAGCAGTCGAAGAACGGCCGATGTCAGGTTCTCTACAGGACTGAGCTGAGCAAGGAGGAATGCTGCAAGACTGGCAGGCTGGGTACCTCATGGACTGAAGAGGATGTACCCAACAGCACCCTCTTCAAATGGATGATATTTCATGGAGGGGCCCCTCACTGCGTCCCCTGCAAAGAAACATGTGAGAACGTAGACTGTGGCCCTGGGAAGAAATGTAAAATGAACAAGAAGAACAAGCCGAGGTGTGTCTGCGCTCCGGATTGTTCCAACATTACTTGGAAAGGTTCCGTGTGCGGAATAGATGGCAAAACCTATAAGGATGAGTGCGCTTTGCTCAAAGCCAAATGTAAAGGGGTCCCGGAGCTGGATGTGCAGTACCAAGGAAAATGCAAAAAAACTTGCAGGGACGTGCTGTGCCCAGGGAGCTCCACTTGTGTGGTGGATCAGACCAATAACGCCTACTGTGTGACATGTAATCGGATTTGCCCGGAGCCTGTCTCCCCTGACCAATATCTGTGTGGGAATGATGGAATAACCTATGCCAGTGCCTGCCACCTGAGGAAGGCTACCTGCCTGCTGGGCAGATCCATTGGATTAGCCTACGAGGGGAAATGCATAAAGGCCAAGTCTTGCGAAGATATTCAGTGCAGCGCTGGAAAGAAATGCCTGTGGGACAGTAGAGTGGGTAGAGGTCGCTGTGCGCTGTGCGATGATGTGTGCGGAGCAGAGAGCAAGTCAGACGATACAGTGTGCGCCAGCGATAACACTACCTACCCCAGCGAGTGCGCAATGAAACAGGCAGCCTGCTCCACGGGGGTTCTTTTGGAAGTCAAACACAGTGGATCTTGCAACTGTAAGTGA
Full Trace Sequence: cgatcataagcagagtccggagttgtgcctggtccattatcccatctctccacttgagactctgctgcttctccactctctgcactgaggatgttaaatgaaaggatccagccgggcatgattttcctcctgactgtctctctgtgccatttcatggaacatcgcgcagtccaagctgggaattgctggctgcagcagtcgaagaacggccgatgtcaggttctctacaggactgagctgagcaaggaggaatgctgcaagactggcaggctgggtacctcatggactgaagaggatgtacccaacagcaccctcttcaaatggatgatatttcatggaggggcccctcactgcgtcccctgcaaagaaacatgtgagaacgtagactgtggccctgggaagaaatgtaaaatgaacaagaagaacaagccgaggtgtgtctgcgctccggattgttccaacattacttggaaaggttccgtgtgcggaatagatggcaaaacctataaggatgagtgcgctttgctcaaagccaaatgtaaaggggtcccggagctggatgtgcagtaccaaggaaaatgcaaaaaaacttgcagggacgtgctgtgcccagggagctccacttgtgtggtggatcagaccaataacgcctactgtgtgacatgtaatcggatttgcccggagcctgtctcccctgaccaatatctgtgtgggaatgatggaataacctatgccagtgcctgccacctgaggaaggctacctgcctgctgggcagatccattggattagcctacgaggggaaatgcataaaggccaagtcttgcgaagatattcagtgcagcgctggaaagaaatgcctgtgggacagtagagtgggtagaggtcgctgtgcgctgtgcgatgatgtgtgcggagcagagagcaagtcagacgatacagtgtgcgccagcgataacactacctaccccagcgagtgcgcaatgaaacaggcagcctgctccacgggggttcttttggaagtcaaacacagtggatcttgcaactgtaagtgaatcactgcaacacagagtaagatttctaaaggcaacccctcagtaatgaagactctttaaagcaaaatacttttttgttgtttctaagggaatgtgagcattatttggcggtatatgtacacccttccagtgacatgacttaagctgcctgcaagatttcggcacttttgcaggaaaagccaaggctatttacaagggggttgcctgagaatatctttccctctatttttctaatttgcttctatgtgcttcgctgattgcttcattaacgctttgagtgacctaactccatccaagtaccagtagtagctttgggttctgtccccggacagaggcctctactaactctgaggacacaagcagtacacctagaacacgagcgctttttgtctgattacaggaatctgcaataacagcctgatccattggttcttcagaactttccgctgttaagacttcatagattatgtaaaaacaaacaaaaaaaaaaagtattatttatcaggtgatgccaaacagcatcccctgcgagtcacatacaatgcaacgctgtattatggctggtcagagggctttgagaaacatgcactgagcttctgcgctgttgttgtccttttttaaacaacagctcccctatattcccccatatagccattgttgaagatacagaggaggaagaggaggaagaggaacaggactacagttttgtcatatcttcatggtaacagctcccaaaactgttggaacagcctctgggcaagaacacatgtccatactgtaaataggtgtatgcttatttattttgggaaagaaaaaaacaaagtatacatatagttgagtctggtagacatttatttatactgtcatgttttataatttatacataaaatgtctgttttgactgtacaccttgttttgaagaaatatattcgtcaaaggaagagcagtgttatttattgtgaaatatcttcgcttgtaaagtccagcttttcttgtaagtccattccttagaggtgattgacggtactgtccactctgctcagcgaaccccttgagtaacggaggaatgcgctgtgccaagagcgtccgtggcgcatagcgcatcacgatagcgcgaatggggttcggcgcttttctttccatgaaccctgcatgtcagtttctaaatgtttatttattggattctctcctttagttctgtacatacatccttcgggttttgtttacaaggaatcttgactgaccaaaagaggctgcagcataacgtgaaaacaaaaaagatgaaaaaaatacaaatatatatatatatctatatatatagaaatatatatatagatatatatttaaaaaaaaaaaaaaggttgaagtggctgtgtttcaggaaatgtcctagtttccattattctaacatactggatggttaaatcccaaagattctttggttccaaacgtgttgatccttcccacctattagatacaaataccaatcatttccatcatgccaattcagacttatttgtgtatttcgacgttttatcagttcaagtttcttgcgttttcataatacattttttttttctgatttcaattttatattttcaaacatggcaagttaaatataaattcatttaaatatatagttttgtacttttttaccatgtaaatgtgtaatgtatataaaagttataatgtgtatttgtaaataaattatgggtgaacaataaaataaatgaaatttgaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MLNERIQPGMIFLLTVSLCHFMEHRAVQAGNCWLQQSKNGRCQVLYRTELSKEECCKTGRLGTSWTEEDVPNSTLFKWMIFHGGAPHCVPCKETCENVDCGPGKKCKMNKKNKPRCVCAPDCSNITWKGSVCGIDGKTYKDECALLKAKCKGVPELDVQYQGKCKKTCRDVLCPGSSTCVVDQTNNAYCVTCNRICPEPVSPDQYLCGNDGITYASACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCSAGKKCLWDSRVGRGRCALCDDVCGAESKSDDTVCASDNTTYPSECAMKQAACSTGVLLEVKHSGSCNCK
Donor tissue: tailbud