ORFeome > fubp1 – XORFeome 2.0

fubp1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis far upstream element (FUSE) binding protein 1, mRNA (cDNA clone MGC:75632 IMAGE:5379441), complete cds
Gene Symbol: fubp1
Gene ID: 394911
ORF gb_acc:
ORF ID: 10174

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC063902

Library Location

Plate ID: GDExt11003
Well Location: H02

EST Sequences

Clone: MGC:75632 IMAGE:5379441
Trimmed Sequence: ATGGCTGATTACTCTACAGTTCCACCACCCAATTCCGGAGCCGGTGTGAACGATGCCTTTAAAGACGCACTTCAGAGAGCGAGACAGATTGCTGCTAAAATTGGAGGTGATACCGGAACAACGATAAATTCAAACGACTATGGATTTGGTGGGCAGAAGAGGCCACTTGATGATGGAGATCAACCAGAGGCCAAAAAAGTTGCTCCTCCAAATGATTCTTTTACTCCATCAATGCCTCCGATGCACCAGCAGCAAAGGTCTGTCGTTACAGAGGAATACAAGGTTCCAGATGGAATGGTGGGATTCATTATTGGCAGAGGAGGCGAACAGATTTCTCGCATTCAGCAGGAGTCTGGCTGCAAAATACAAATTGCTCCAGATAGTGGAGGCATGCCCGATAGGTCTTGTATGCTTACTGGATCCCCTGATTCTGTTCAAGCTGCAAAAAGGTTACTCGACCAGATTGTTGAAAAAGGAAGACCAACTCCTGGGTTTCATCATGGAGAGGGTTCAGGAAATGCCGTCCAAGAAATAATGATTCCTGCCAGTAAAGCTGGATTAGTAATTGGAAAGGGAGGAGAAACCATTAAGCAACTCCAGGAAAGAGCTGGCGTTAAGATGGTCATGATCCAAGATGGACCCCAAAACACAGGAGCTGACAAGCCTTTAAGAATTGCAGGGGATCCATACAAAGTACAGCAAGCAAAGGAAATGGTGTTAGAATTGATTCGCGATCAAGGAGGTTTCAGAGAAATTCGGAATGAGTATGGCTCAAGAATAGGAGGAAATGAAGGGATAGATGTTCCTATACCACGATTTGCTGTTGGAATTGTGATAGGCAGAAATGGCGAAATGATTAAGAAAATACAGAATGATGCAGGTGTTAGAATACAGTTCAAACCAGATGACGGATCTACTCCAGAAAGGATTGCACAAATTACTGGCCCCCAAGACAGATGTCAACATGCTGCTGAAATTATAAATGACCTGCTGCGTAGTGTTCAGTCAGGAAATGCTGGTGGACCAGGGCCTGGTGGCAGAGGAAGAGGCAGAGGGCAAGGAAACTGGAATATGGGACCTCCAGGTGGTTTACAGGAATTCAACTTTGTTGTTCCCACAGTGAAAACAGGCCTTATAATTGGAAAAGGTGGGGAAACAATTAAAAATATAAGCCAGCAGTCTGGGGCTCGGATAGAGCTGCAGCGGAATCCCCCACCAAATGCGGATCCCAATGTAAAGTTATTTACTATCCGTGGATCTCCACAACAGATAGACTATGCCCGGCAGCTGGTTGAAGAAAAGATAGGCGGTCCTGTAAATCCCTTGGGGCCCCCGGTTCCTCATGGTCCACCTGGTGTTCCAGGACCTCATGGCCCACCAGGTCCTCCTGGCCCTGGTGCTCCTATGGGACCTTACAATCCACCACCTTATAATCCTGGCCCTCCAGGACCTGCACCACATGGACCCCCTGCTCCATATACTCCTCAAGGATGGGGCAATACTTATCCACACTGGCAGCAACCAAGCCAGCCAGACCCAAGTAAAGCAGCTACAGACCCTAATTCTGCAGCATGGGCAGCTTATTATGCACACTATTATCAGCAGCAAGCACCCCAACCACCCGCAGCTCCAAATGCTGCACCAACTACAACACAAACTAACGGGCAAGCTGAACCTCCAGCTGCTGCACCCCCAGCTGGGCAAGTGGATTACACAAAGGCTTGGGAGGAGTATTACAAGAAAATAGGTCAGCAAGGGCCACCACAAGATTATACAAAAGCATGGGAAGAATATTACAAAAAACAAGGGCAAACCGTTCCAACTCCAGGAGCTGCACCGCCTGCAGGACAACCAGATTACAGTGCAGCCTGGGCAGAGTATTACCGACAGCAAGCAGCATATTATGCTCAAACAAGTCCACAAGGGATGCCACAACATCCGCCAGCACCACAGGGCCAATAA
Full Trace Sequence: agacgtgcttgttgaggcgagatggctgattactctacagttccaccacccaattccggagccggtgtgaacgatgcctttaaagacgcacttcagagagcgagacagattgctgctaaaattggaggtgataccggaacaacgataaattcaaacgactatggatttggtgggcagaagaggccacttgatgatggagatcaaccagaggccaaaaaagttgctcctccaaatgattcttttactccatcaatgcctccgatgcaccagcagcaaaggtctgtcgttacagaggaatacaaggttccagatggaatggtgggattcattattggcagaggaggcgaacagatttctcgcattcagcaggagtctggctgcaaaatacaaattgctccagatagtggaggcatgcccgataggtcttgtatgcttactggatcccctgattctgttcaagctgcaaaaaggttactcgaccagattgttgaaaaaggaagaccaactcctgggtttcatcatggagagggttcaggaaatgccgtccaagaaataatgattcctgccagtaaagctggattagtaattggaaagggaggagaaaccattaagcaactccaggaaagagctggcgttaagatggtcatgatccaagatggaccccaaaacacaggagctgacaagcctttaagaattgcaggggatccatacaaagtacagcaagcaaaggaaatggtgttagaattgattcgcgatcaaggaggtttcagagaaattcggaatgagtatggctcaagaataggaggaaatgaagggatagatgttcctataccacgatttgctgttggaattgtgataggcagaaatggcgaaatgattaagaaaatacagaatgatgcaggtgttagaatacagttcaaaccagatgacggatctactccagaaaggattgcacaaattactggcccccaagacagatgtcaacatgctgctgaaattataaatgacctgctgcgtagtgttcagtcaggaaatgctggtggaccagggcctggtggcagaggaagaggcagagggcaaggaaactggaatatgggacctccaggtggtttacaggaattcaactttgttgttcccacagtgaaaacaggccttataattggaaaaggtggggaaacaattaaaaatataagccagcagtctggggctcggatagagctgcagcggaatcccccaccaaatgcggatcccaatgtaaagttatttactatccgtggatctccacaacagatagactatgcccggcagctggttgaagaaaagataggcggtcctgtaaatcccttggggcccccggttcctcatggtccacctggtgttccaggacctcatggcccaccaggtcctcctggccctggtgctcctatgggaccttacaatccaccaccttataatcctggccctccaggacctgcaccacatggaccccctgctccatatactcctcaaggatggggcaatacttatccacactggcagcaaccaagccagccagacccaagtaaagcagctacagaccctaattctgcagcatgggcagcttattatgcacactattatcagcagcaagcaccccaaccacccgcagctccaaatgctgcaccaactacaacacaaactaacgggcaagctgaacctccagctgctgcacccccagctgggcaagtggattacacaaaggcttgggaggagtattacaagaaaataggtcagcaagggccaccacaagattatacaaaagcatgggaagaatattacaaaaaacaagggcaaaccgttccaactccaggagctgcaccgcctgcaggacaaccagattacagtgcagcctgggcagagtattaccgacagcaagcagcatattatgctcaaacaagtccacaagggatgccacaacatccgccagcaccacagggccaataatgcgaagtggacagtacagtatttgcttcattgtgttggggaaaacctttgttaaatatatggatgcagacgccttgatgaagatcttaattttttgtttcggtttaaaattgttttgaaaaaaatgtacaaaactatcactactgactgataggaggctatatttctgtgtagaaatgaaaactggtttgtttttagtatattagtgtagatgtacacattccagcaaatgtatttgcaactatgtggtcaatgctttgtcatacaaatgtactttttcaatgtatactttatgacttttaaaatgcctgttttgtgctttacaataaataatatgaaacctcctgtgtcggtaagttggatatgtgagtatttaaactatcatttgtttgttttttttttatttgacggggggagggatatctgttcaattttattactgctttgaagaaaagtagattgccagtttttaagctcttacttgacagattttactcagtttaattttcaagaacttgttttaatagggacctgtgacagattgttgtatacccatcagtagtggatgctttttgttttgttgcatgtataaattggactgcagtccttattttttctcccactgagtaaagtttttgtatatgaccacttttcagaactgtagggctgtgctcttctgcctccaaacattttgttgttgtttttttttatactttatctgcataaacaatattttcagaaagtttgtattgacgttatttgcatattcttttggaagataacctttctgtagtaacattgttttgctgctggttatgctgaataattagctattagaattttctgaatgttgaaaatgaacgttaatacagtcagctttaaaatctgaatactaaaaatttcaaaagtattaataaccgtttatcacctcagtcaaattataatttttttacaaataaactttgatttcaatgtccaaaaaaaaaaaaaaaaa
Translation: MADYSTVPPPNSGAGVNDAFKDALQRARQIAAKIGGDTGTTINSNDYGFGGQKRPLDDGDQPEAKKVAPPNDSFTPSMPPMHQQQRSVVTEEYKVPDGMVGFIIGRGGEQISRIQQESGCKIQIAPDSGGMPDRSCMLTGSPDSVQAAKRLLDQIVEKGRPTPGFHHGEGSGNAVQEIMIPASKAGLVIGKGGETIKQLQERAGVKMVMIQDGPQNTGADKPLRIAGDPYKVQQAKEMVLELIRDQGGFREIRNEYGSRIGGNEGIDVPIPRFAVGIVIGRNGEMIKKIQNDAGVRIQFKPDDGSTPERIAQITGPQDRCQHAAEIINDLLRSVQSGNAGGPGPGGRGRGRGQGNWNMGPPGGLQEFNFVVPTVKTGLIIGKGGETIKNISQQSGARIELQRNPPPNADPNVKLFTIRGSPQQIDYARQLVEEKIGGPVNPLGPPVPHGPPGVPGPHGPPGPPGPGAPMGPYNPPPYNPGPPGPAPHGPPAPYTPQGWGNTYPHWQQPSQPDPSKAATDPNSAAWAAYYAHYYQQQAPQPPAAPNAAPTTTQTNGQAEPPAAAPPAGQVDYTKAWEEYYKKIGQQGPPQDYTKAWEEYYKKQGQTVPTPGAAPPAGQPDYSAAWAEYYRQQAAYYAQTSPQGMPQHPPAPQGQ
Donor tissue: tailbud