ORFeome > galk2 – XORFeome 2.0

galk2 – XORFeome 2.0

General Information

Species: Xenopus tropicalis galactokinase 2, mRNA (cDNA clone MGC:89048 IMAGE:7005387), complete cds
Gene Symbol: galk2
Gene ID: 448280
ORF gb_acc: MG134127
ORF ID: 11755

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC075352

Library Location

Plate ID: GDExt11017
Well Location: A05

EST Sequences

Clone: MGC:89048 IMAGE:7005387
Trimmed Sequence: ATGGCAGCCTCCGCATCCCCGCCGACCCTCCGGGTGCATCCCTCACAGAATGACAGGTTGTTGAAGTTAAAAGAAATATTTGTCTCCAAATATGGATCCGTGCCTTCATTTTATGCCCGAGCTCCAGGACGTGTCAACTTAATAGGTGAGCATATTGATTACTGTGGCTATGCTGTTCTTCCCATGGCTATTGAGCAAGACATATTAGCAGCTGTGCAGATCAGCAATGATCAAGTTGTTGAGCTGTCCAATACAAACCTGTCCTACGTGGACTTCTCTGTAAATGTAAATGACATCAAGATTGATAAAACTAAGCCTTTATGGCACAACTACTTTCTGTGCGGACTGAAAGGAATTCAGGACCATTTCTGTCTGAGCAGCCCTACTGGAATGAAATGTTTGGTAGATGGAACTATTCCTGCAAGTTCGGGTCTTTCTAGTTCTAGTGCCTTGGTCTGCTGTGCTGGGCTTGTTACTCTTATTGCTAATAAGAAGTCTATGTCAAAGGTGGAGCTTGCTGAGACATGTGCAAAATGTGAGCGTTATATTGGCACAGAGGGTGGCGGCATGGACCAATCCATCTCATTCCTTGCAGAAGAAGGAACTGCTAAGCTGATTGAATTTAGCCCACTGAGATCAACTGATGTGAAGCTTCCAGCTGGGGCAGTTTTTGTCATTGCTAACAGTTGTGTTGAAATGAATAAAGCAGCAACGTCACATTTTAATATAAGGGTCATGGAGTGTCGGCTAGCTACTAAGGTTATTGCAAAAGCAAAAGGGCTAGACTGGAAAAACCTGATGAAATTAGGAGATCTGCAAGCCAAACTTGGGGTCAGCTTTGAGGATATTATGGCTGTAGTGGAGGAAATTCTTCACCCAGAGCCGTACACAAGAGAGGAAATTTGTGAATGTTTGGGTATGAGCTTAGAAGAACTCTGTGAGAAAATACTCAGCCAAAACACACAGGATGTTGCCACCTTCAGATTGTATCAGCGAGCGAAACACGTGTACAGTGAGGCTGCCCGAGTCCTTGCCTTTAAGAAGGTTTGTGATGAGGCACCTGCCAACGCCGTCCATCTGCTGGGGGACCTCATGAACCAGAGCCACGTGAGCTGCCGAGACATGTACGAATGCAGCTGCCCTGAACTGGATCAGCTGGTGGACATCTGCCTGAAATCAGGGGCTGTGGGTTCCCGCCTGACGGGGGCTGGATGGGGAGGCTGCACCGTCTCTATGGTTCCAGTGGACAAACTCAGTGACTTCCTTTCCAACGTGCAAGATTCTTACTACAAATTGGAAGACCGAAGGTTTGCGCTGCTGGAAAAGAGTCTCTTTGCCACAAATCCTGGACGCGGAGCAGTGGTTCTTATGGAAGCAGAATAA
Full Trace Sequence: gttcttccattgagacatggcagcctccgcatccccgccgaccctccgggtgcatccctcacagaatgacaggttgttgaagttaaaagaaatatttgtctccaaatatggatccgtgccttcattttatgcccgagctccaggacgtgtcaacttaataggtgagcatattgattactgtggctatgctgttcttcccatggctattgagcaagacatattagcagctgtgcagatcagcaatgatcaagttgttgagctgtccaatacaaacctgtcctacgtggacttctctgtaaatgtaaatgacatcaagattgataaaactaagcctttatggcacaactactttctgtgcggactgaaaggaattcaggaccatttctgtctgagcagccctactggaatgaaatgtttggtagatggaactattcctgcaagttcgggtctttctagttctagtgccttggtctgctgtgctgggcttgttactcttattgctaataagaagtctatgtcaaaggtggagcttgctgagacatgtgcaaaatgtgagcgttatattggcacagagggtggcggcatggaccaatccatctcattccttgcagaagaaggaactgctaagctgattgaatttagcccactgagatcaactgatgtgaagcttccagctggggcagtttttgtcattgctaacagttgtgttgaaatgaataaagcagcaacgtcacattttaatataagggtcatggagtgtcggctagctactaaggttattgcaaaagcaaaagggctagactggaaaaacctgatgaaattaggagatctgcaagccaaacttggggtcagctttgaggatattatggctgtagtggaggaaattcttcacccagagccgtacacaagagaggaaatttgtgaatgtttgggtatgagcttagaagaactctgtgagaaaatactcagccaaaacacacaggatgttgccaccttcagattgtatcagcgagcgaaacacgtgtacagtgaggctgcccgagtccttgcctttaagaaggtttgtgatgaggcacctgccaacgccgtccatctgctgggggacctcatgaaccagagccacgtgagctgccgagacatgtacgaatgcagctgccctgaactggatcagctggtggacatctgcctgaaatcaggggctgtgggttcccgcctgacgggggctggatggggaggctgcaccgtctctatggttccagtggacaaactcagtgacttcctttccaacgtgcaagattcttactacaaattggaagaccgaaggtttgcgctgctggaaaagagtctctttgccacaaatcctggacgcggagcagtggttcttatggaagcagaataaactttgttccaatcaaaagtataactttgctcaaagttttcactgctttgtagcattttaagcatatttttcaaatgaataaaaacacatattatttcctgggaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MAASASPPTLRVHPSQNDRLLKLKEIFVSKYGSVPSFYARAPGRVNLIGEHIDYCGYAVLPMAIEQDILAAVQISNDQVVELSNTNLSYVDFSVNVNDIKIDKTKPLWHNYFLCGLKGIQDHFCLSSPTGMKCLVDGTIPASSGLSSSSALVCCAGLVTLIANKKSMSKVELAETCAKCERYIGTEGGGMDQSISFLAEEGTAKLIEFSPLRSTDVKLPAGAVFVIANSCVEMNKAATSHFNIRVMECRLATKVIAKAKGLDWKNLMKLGDLQAKLGVSFEDIMAVVEEILHPEPYTREEICECLGMSLEELCEKILSQNTQDVATFRLYQRAKHVYSEAARVLAFKKVCDEAPANAVHLLGDLMNQSHVSCRDMYECSCPELDQLVDICLKSGAVGSRLTGAGWGGCTVSMVPVDKLSDFLSNVQDSYYKLEDRRFALLEKSLFATNPGRGAVVLMEAE
Donor tissue: