ORFeome > gja7 – XORFeome 2.0

gja7 – XORFeome 2.0

General Information

Species: Xenopus tropicalis gap junction protein, alpha 7, 45kDa (connexin 45), mRNA (cDNA clone MGC:75965 IMAGE:5384187), complete cds
Gene Symbol: gja7
Gene ID: 403098
ORF gb_acc: MG133503
ORF ID: 11027

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC066131

Library Location

Plate ID: GDExt11010
Well Location: E03

EST Sequences

Clone: MGC:75965 IMAGE:5384187
Trimmed Sequence: ATGAGCTGGAGTTTCTTAACGCGTCTCCTCGAGGAGATCAACAACCACTCGACGTTCGTCGGGAAGGTCTGGCTGACGGTGCTCATCATATTCCGGATCGTCCTGACCGCGGTCGGCGGGGAGTCCATATACTACGATGAACAGAGTAAATTCACGTGCAACACGCAGCAACCCGGTTGCGAGAACGTGTGCTACGACGCCTTTGCGCCCCTGTCGCACGTTCGGTTCTGGGTCTTCCAGATCATCCTCATCACCACCCCGTCCATTATGTACCTGGGGTTCGCCATGCACCGGATTGCGCGCCAGCCCGAGATGCAGATAAGGCGCTCGGAGAAAACCAAAAGCAAAAAGCGCGCTCCCATAATTCATCGGGGGGCCATGAGAGACTACGAAGAGGCTGAAGATAACCAAGAGGAAGATCCCATGATTTGTGAAGAAGAGGAACCCGAGAAAGACAGCGAGAAGGGAGACAAAAAGAAGCACGATGGGCGCCGGCGGATCAAACAAGATGGCCTGATGAAGGTCTACGTGTTGCAGTTGCTCTTCCGTTCGGTGTTTGAAGTCGGCTTCCTGATGGGCCAGTACATACTGTATGGGTTCGAGGTCATTCCCTTTTTCGTGTGCTCCCGGAAACCGTGCCCTCACACCGTCGACTGCTTCGTGTCACGCCCCACCGAGAAGACCATCTTCCTGCTGATCATGTACGCCGTCAGTGCGCTCTGCCTCTTCCTCAACCTGTGCGAGCTCTTCCACTTGGGCATAGGGGGCATCCGAGATGCCCTCCGGCAGAAGAAGAAAGAACTTCAGGAATCCCGTAAAAAGACCCCCAGTGCCCCACCAAATTACCACTCTGTCCTGAAGAAAGGCAGGCTGCCCAACGGGAAACCCGTTTTCCCAGGCAACGGAGTGTCCGAAGGCTTCGAGTTGCCGACACACGAGCTGGACAGGTTACGGCAGCACCTCAAGTTGGCTCAGGAGCATCTCGACTTGGCTTTCCACCTCAACCCAACGGGCGATAATACCCACGCGTCCCGGAGCAGCAGCCCCGAGTCCAACAGCATTGCCGCCGAACAGAATCGCCTAAACTTGGCACAAGAGAAGGGAGTGGGAAACCGGGAAAAATCTGGTTTGTGA
Full Trace Sequence: gttagagttaagcagaaggagcaagtgaagtgtctctgccacgttatttagagctgatcggggctcacaatgagctggagtttcttaacgcgtctcctcgaggagatcaacaaccactcgacgttcgtcgggaaggtctggctgacggtgctcatcatattccggatcgtcctgaccgcggtcggcggggagtccatatactacgatgaacagagtaaattcacgtgcaacacgcagcaacccggttgcgagaacgtgtgctacgacgcctttgcgcccctgtcgcacgttcggttctgggtcttccagatcatcctcatcaccaccccgtccattatgtacctggggttcgccatgcaccggattgcgcgccagcccgagatgcagataaggcgctcggagaaaaccaaaagcaaaaagcgcgctcccataattcatcggggggccatgagagactacgaagaggctgaagataaccaagaggaagatcccatgatttgtgaagaagaggaacccgagaaagacagcgagaagggagacaaaaagaagcacgatgggcgccggcggatcaaacaagatggcctgatgaaggtctacgtgttgcagttgctcttccgttcggtgtttgaagtcggcttcctgatgggccagtacatactgtatgggttcgaggtcattccctttttcgtgtgctcccggaaaccgtgccctcacaccgtcgactgcttcgtgtcacgccccaccgagaagaccatcttcctgctgatcatgtacgccgtcagtgcgctctgcctcttcctcaacctgtgcgagctcttccacttgggcatagggggcatccgagatgccctccggcagaagaagaaagaacttcaggaatcccgtaaaaagacccccagtgccccaccaaattaccactctgtcctgaagaaaggcaggctgcccaacgggaaacccgttttcccaggcaacggagtgtccgaaggcttcgagttgccgacacacgagctggacaggttacggcagcacctcaagttggctcaggagcatctcgacttggctttccacctcaacccaacgggcgataatacccacgcgtcccggagcagcagccccgagtccaacagcattgccgccgaacagaatcgcctaaacttggcacaagagaagggagtgggaaaccgggaaaaatctggtttgtgatcgtggcaagcgggtgggccggccggagggggggatggaatggcttcttgttcaactggaatcaagttactaaaaggttcttgaccctctcctggcagggggggagcaccgagggcgaggggaagcgaagaaaagaactatttttttggggcgggggggtttgttgggggaagggtcggaggtttgaatgcacctctgtgttcagctgccattggccctcacaaacagtcgccgtgtcgtacgtcccgtggcaacgccgccagcgccgggcgaggtttagcaccactggtttacgtaggctgccggctcttctgccctctggttacagggcgagagacgcttcagcctaaacatatttttatttgaatcttgatatttttgtgcgtcctggaagctgctgccaacgctcgtactgtgccgccgcgtgcgctggaatagttcaactagctcgcggccgtagcttcgtttcaactcttttatacgatactcagcattaaactaaagggagatttttccttttttatgttttttttttttttttttttaattttctttttagatgtagttccattccgggtttgtacatgtgactacgcggcggtactctgagcccatcagtaccagcacaccttcccccctccaactgcagttgtgttcggagggggtttaaaggggaaataagccttttatttgcattcctgggttctgctaaagcgccgaccctcccagttgacttcctgttgaactacaaatcccagcatcccctgaggggctaagtgttgccatttagaggcagcaggagggtcgaaaggtggaattccctgttatttttctatgtatttctggatttgacagactttgggaggaaagcttgagagccggcacccacgctggctggggctgtgccaaatacacatgattagggggaaggggcgactcatttttccatctgccccccccccccttttttttttgaaagctttaaacattccagaggcactctttctgcacacaccttttgtacgtggagtggtacggccggcggtatattaagagccatggaatgtacctttccagtttgcagaggggggggggggagtttgcccaataatttttgctgttaaatggggcacttgagttcccggtgcccccgaccgctggaggggaacccgcacattctatcagtcgccacctgctccttcgcaaattccaaaaaagcctcttgtgcctaggagcgagggggctgctgtatgtacagaggggaacagctgtttgtaatgctgacattaacccattggttgctggtttcttggcggcattatagcacatctccccccccccatcacctcccgtgcctttaaagataaaatacaagtttctatggcagagcaccctgttactctacaaacattccatattctccttagaactggaacctgctcttttccactagggggagccatttccatgatctcaagcattactgcatcctctccaggaagctgggggtgcaacgggaaatgagccccctggcacttgcatggaaaggagaatgaccctcccctgagtttattccttatcgggtgccacgttagcttttattttaatgtgaatttttagttttttagcattaattgcattattttagtgtttaactagttgccttatgtcctcagtagctgcccatggtatggttcctgggttcttaggttgggcattgcggagttctagtgccgcggctagctctctgggagccaggctattatgtatatgcacccaataggggtgacttacccaacgcagggtacaaactgccacggccagggttgccccaccctacagactcccaagctaggagtggcacaaagccctgtagttactacttggcaagaggtatgggggtgcctagtgacccccaggtacaagtaatcttttgactgaggactaccccccccatatgcccttccactacccactggcccctcaggcctgggcatgtataagagggcactgcggtcactgagctgattgccccctcattttttctggggggtattatattgttttcactctgcccctattctgcatcacatggtacagaatcattccaatggggcacggggcaagtagcagcgacaaaaccaggaaagtttcacggatccctttgcattatggtcaatgggaagggacacacagagcacccatgggtgcactccctatatatgtgtgtcagtcagggactctcagcgcccatagcgagaagcgctctactttcccgtagaatggcgacacgtcgttcggatttagtctccatggtaacagtgtgctctttcataggaaaccattccccccccccccccccttgtattttattcttctttatctttgctggagacgcttgaaatttttacagacatctcattgcctcatctctttatatgataggatatttgtctttagtaggggggtctgtatggttttgttttattgaagacttattggtactggaaacattatgtttttgttttttttatacaatgttattaaaaaaaaatgaaaattgaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSWSFLTRLLEEINNHSTFVGKVWLTVLIIFRIVLTAVGGESIYYDEQSKFTCNTQQPGCENVCYDAFAPLSHVRFWVFQIILITTPSIMYLGFAMHRIARQPEMQIRRSEKTKSKKRAPIIHRGAMRDYEEAEDNQEEDPMICEEEEPEKDSEKGDKKKHDGRRRIKQDGLMKVYVLQLLFRSVFEVGFLMGQYILYGFEVIPFFVCSRKPCPHTVDCFVSRPTEKTIFLLIMYAVSALCLFLNLCELFHLGIGGIRDALRQKKKELQESRKKTPSAPPNYHSVLKKGRLPNGKPVFPGNGVSEGFELPTHELDRLRQHLKLAQEHLDLAFHLNPTGDNTHASRSSSPESNSIAAEQNRLNLAQEKGVGNREKSGL
Donor tissue: neurula