ORFeome > gjd4 – XORFeome 2.0

gjd4 – XORFeome 2.0

General Information

Species: Xenopus tropicalis gap junction protein, delta 4, 40.1kDa, mRNA (cDNA clone MGC:75599 IMAGE:5379220), complete cds
Gene Symbol: gjd4
Gene ID: 394684
ORF gb_acc: MG132801
ORF ID: 10136

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC062485

Library Location

Plate ID: GDExt11002
Well Location: H04

EST Sequences

Clone: MGC:75599 IMAGE:5379220
Trimmed Sequence: ATGGAGTATTTAGACTCAGTGGGATATTTAATCATCACTTTTAACTACAATGTTACTGCAATTGGGAAGGTCTGGCTCACATTAATGCTTTTGCTGAGGATGGCTATGGTGTTATTTGCCGGATACCCTCTTTATCAAGATGAGCAGGAGCGTTTTATCTGCAATACCTTACAGCCCGGCTGCTCCAATGTCTGCTACGACATCTTCTCCCCTGTGTCCCACATGAGATTTTGGCTTTTCCAGACCATGATAGTCTTTCTACCCTATGCTATGTTCGCTGTTCACATTTTGCACCGAGTGGTTGGCTACATGGCACCAACAAATGATCACTTCCGGAAAAGCAACACCCCGACTTATCATGGCGTGGGCTTACAGATGGAGATACCTGATTTTTCCTTGGCGTATATAGTCCAATTACTTCTGAGAACTCTTCTAGAGGCTGGTTTCTGCACGGGGCAGTATTTTCTCTTTGGGATATTAGTTCCAAAGAGATTCAGCTGTTCTCAGGCCCCCTGCACCAGCAGTGTTGATTGTTACATCTCTAGACCCACTGAAAAGTCTCTCATGATGATCTTTATCTGGGGGACAGGAGTGATATCTCTCATACTTGGGCTGGTGGACCTCATTTACGTAATCCATCGGCGAAGGCGCTCCGAGCGCCTAAAGAGAGAACTGCTTCTGCTGGAAAACGACTCCCTAAAAGGTGGCTGCTGTTCTGATTCACCTCCAAATTCAAACTTGCACGGCGCTCCGGAGCCAATGGCCTTGTACGCTGATTCTGCTTCCAATGATCTTGAAAAAATAGAGGAGAAAATTAAGGGCGACTCCCATTCTCTGCCATCGTATGAAGGGGAAACGGCTTCTTTTCAGACAGAAAGTTCTCACCATGATGTGGGAAAGTCCAACATGAACACCAACAGCAATAAATCATGTTCTTGGCAAGTCAGCCTGACTTCTGCCGACGGCAAACCCACCAAGAGTGATCACCACTTGGTCATCCCAAGGCAGCTCAAACCAAAGCAGGAGAATTGCAGCAGCTCTAATCTGGGAATACTCAGCCCCCCTGAAAAATCCCCAGCGTCCAAATCCAAGAAATCTGAGTGGGTTTAA
Full Trace Sequence: cgcagccagaagcctccgtgtatctcccctgtcccttgcagacatgtaatgtgtagggcaaatctgtcctgccaggaaactgatgatttactccatggaaccttcattcatggcttgcgtttccttttatctgttgtaaaaaaaacccctcttgttatcgggagcgaggcgacattggccaccatggagtatttagactcagtgggatatttaatcatcacttttaactacaatgttactgcaattgggaaggtctggctcacattaatgcttttgctgaggatggctatggtgttatttgccggataccctctttatcaagatgagcaggagcgttttatctgcaataccttacagcccggctgctccaatgtctgctacgacatcttctcccctgtgtcccacatgagattttggcttttccagaccatgatagtctttctaccctatgctatgttcgctgttcacattttgcaccgagtggttggctacatggcaccaacaaatgatcacttccggaaaagcaacaccccgacttatcatggcgtgggcttacagatggagatacctgatttttccttggcgtatatagtccaattacttctgagaactcttctagaggctggtttctgcacggggcagtattttctctttgggatattagttccaaagagattcagctgttctcaggccccctgcaccagcagtgttgattgttacatctctagacccactgaaaagtctctcatgatgatctttatctgggggacaggagtgatatctctcatacttgggctggtggacctcatttacgtaatccatcggcgaaggcgctccgagcgcctaaagagagaactgcttctgctggaaaacgactccctaaaaggtggctgctgttctgattcacctccaaattcaaacttgcacggcgctccggagccaatggccttgtacgctgattctgcttccaatgatcttgaaaaaatagaggagaaaattaagggcgactcccattctctgccatcgtatgaaggggaaacggcttcttttcagacagaaagttctcaccatgatgtgggaaagtccaacatgaacaccaacagcaataaatcatgttcttggcaagtcagcctgacttctgccgacggcaaacccaccaagagtgatcaccacttggtcatcccaaggcagctcaaaccaaagcaggagaattgcagcagctctaatctgggaatactcagcccccctgaaaaatccccagcgtccaaatccaagaaatctgagtgggtttaatgagtgggtaaatgttggcattgttttgtgattgatgtttcagagtctaaacgctcagtgtttatagttagagttttgtcctgttttagcaatgtgttttggttatagaacattttcataaacattattaatattataacatttagaaaaaaaaaaaaaaaaaaaa
Translation: MEYLDSVGYLIITFNYNVTAIGKVWLTLMLLLRMAMVLFAGYPLYQDEQERFICNTLQPGCSNVCYDIFSPVSHMRFWLFQTMIVFLPYAMFAVHILHRVVGYMAPTNDHFRKSNTPTYHGVGLQMEIPDFSLAYIVQLLLRTLLEAGFCTGQYFLFGILVPKRFSCSQAPCTSSVDCYISRPTEKSLMMIFIWGTGVISLILGLVDLIYVIHRRRRSERLKRELLLLENDSLKGGCCSDSPPNSNLHGAPEPMALYADSASNDLEKIEEKIKGDSHSLPSYEGETASFQTESSHHDVGKSNMNTNSNKSCSWQVSLTSADGKPTKSDHHLVIPRQLKPKQENCSSSNLGILSPPEKSPASKSKKSEWV
Donor tissue: tailbud