ORFeome > gna11 – XORFeome 2.0

gna11 – XORFeome 2.0

General Information

Species: Xenopus tropicalis guanine nucleotide binding protein (G protein), alpha 11 (Gq class), mRNA (cDNA clone MGC:76069 IMAGE:5307657), complete cds
Gene Symbol: gna11
Gene ID: 394755
ORF gb_acc: MG132730
ORF ID: 10029

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061608

Library Location

Plate ID: GDExt11001
Well Location: G08

EST Sequences

Clone: MGC:76069 IMAGE:5307657
Trimmed Sequence: ATGACTCTGGATTCAATGATGGCCTGCTGCCTGAGCGAGGAGGTAAAGGAATCCAAGAGAATCAACGCGGAGATCGAGAAGCAGCTGAGGAGGGACAAGAAAGACTCTCGGCGGGAGCTCAAATTGCTTTTGCTCGGTACTGGAGAGAGTGGAAAAAGCACATTCATTAAACAGATGAGGATTATTCATGGCTCTGGCTATTCTGAAGAAGACAAGAGGGGATTTACCAAGCTAGTTTTTCAGAATATCTTCACTGCCATGCAGTCTATGATAAGAGCCATGGATACACTAAAAATTCCCTACAAGTGTGAACAGAACAAGGCCAATGCTCAAGTAGTGCGAGAAGTGGACGTAGAGAAAGTATGTACCTTTGAACAGCCATATGTGAATGCAATCAAGAACCTGTGGAGTGACCCTGGGATCCAGGAGTGCTATGATCGACGGCGAGAGTACCAACTGTCAGATTCTGCCAAGTATTACCTGACAGATGTGGACCGGATTTCAAAACCCGGCTACCTGCCCACGCAACAAGATGTGCTGCGTGTAAGAGTGCCAACTACGGGTATAATAGAGTACCCTTTTGATTTGGAGAACATCATCTTCAGGATGGTAGATGTTGGTGGTCAGAGGTCTGAACGAAGGAAATGGATTCATTGCTTTGAGAATGTCACTTCCATCATGTTCCTTGTAGCCCTTAGTGAATATGACCAGGTTCTTGTGGAGTCTGATAATGAGAATCGGATGGAGGAGAGTAAGGCACTGTTCAGGACCATAATAACATACCCTTGGTTCCAAAATTCCTCTGTCATTCTGTTTCTAAATAAAAAGGATCTGCTGGAAGATAAGATCATGTATTCCCACCTCGTAGACTATTTTCCTGAATTTGATGGCCCTCAACGCGATGCTGCAACAGCTCGTGAGTTCATTTTGAAGATGTTTGTGGACCTGAATCCCGACAGTGACAAGATCATCTATTCGCACTTCACCTGTGCCACAGATACCGAAAACATACGCTTTGTCTTCGCTGCTGTCAAAGACACCATACTACAGCACAACCTTAAAGAGTACAACCTGGTGTAA
Full Trace Sequence: gagaggcccccggtgcgggccacagtgccggggggaagggatgactctggattcaatgatggcctgctgcctgagcgaggaggtaaaggaatccaagagaatcaacgcggagatcgagaagcagctgaggagggacaagaaagactctcggcgggagctcaaattgcttttgctcggtactggagagagtggaaaaagcacattcattaaacagatgaggattattcatggctctggctattctgaagaagacaagaggggatttaccaagctagtttttcagaatatcttcactgccatgcagtctatgataagagccatggatacactaaaaattccctacaagtgtgaacagaacaaggccaatgctcaagtagtgcgagaagtggacgtagagaaagtatgtacctttgaacagccatatgtgaatgcaatcaagaacctgtggagtgaccctgggatccaggagtgctatgatcgacggcgagagtaccaactgtcagattctgccaagtattacctgacagatgtggaccggatttcaaaacccggctacctgcccacgcaacaagatgtgctgcgtgtaagagtgccaactacgggtataatagagtacccttttgatttggagaacatcatcttcaggatggtagatgttggtggtcagaggtctgaacgaaggaaatggattcattgctttgagaatgtcacttccatcatgttccttgtagcccttagtgaatatgaccaggttcttgtggagtctgataatgagaatcggatggaggagagtaaggcactgttcaggaccataataacatacccttggttccaaaattcctctgtcattctgtttctaaataaaaaggatctgctggaagataagatcatgtattcccacctcgtagactattttcctgaatttgatggccctcaacgcgatgctgcaacagctcgtgagttcattttgaagatgtttgtggacctgaatcccgacagtgacaagatcatctattcgcacttcacctgtgccacagataccgaaaacatacgctttgtcttcgctgctgtcaaagacaccatactacagcacaaccttaaagagtacaacctggtgtaaccaagcacccacctcccctcaacctcctccccttcattagaaagttggggtcagccccatcaccagaaagcaaagcactggtgtgagcgaaggggaggaggcttcagtcttgcttttgtttttattatctttttttattataattttattttgtttctaaatgggatgatttttgccaaattagtaaaggtgcagcttattgctgctccgtatgcctttgataagtcgttaaaaatcatgggtttatatttcaaatagcctcttaatatttcttgtattaaaacagtaagaagggcaatagagcagggagtctggtgagagcctgcttgctcaccctacagcaattttctccagtttttattcacaaaattcgaaaaaaaaaaaaaaaa
Translation: MTLDSMMACCLSEEVKESKRINAEIEKQLRRDKKDSRRELKLLLLGTGESGKSTFIKQMRIIHGSGYSEEDKRGFTKLVFQNIFTAMQSMIRAMDTLKIPYKCEQNKANAQVVREVDVEKVCTFEQPYVNAIKNLWSDPGIQECYDRRREYQLSDSAKYYLTDVDRISKPGYLPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEDKIMYSHLVDYFPEFDGPQRDAATAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQHNLKEYNLV
Donor tissue: gastrula