ORFeome > gna11 – XORFeome 2.0

gna11 – XORFeome 2.0

General Information

Species: Xenopus tropicalis guanine nucleotide binding protein (G protein), alpha 11 (Gq class), mRNA (cDNA clone MGC:89428 IMAGE:6990483), complete cds
Gene Symbol: gna11
Gene ID: 394755
ORF gb_acc: MG133863
ORF ID: 11445

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC075529

Library Location

Plate ID: GDExt11014
Well Location: H10

EST Sequences

Clone: MGC:89428 IMAGE:6990483
Trimmed Sequence: ATGACTCTGGATTCAATGATGGCCTGCTGCCTGAGCGAGGAGGTAAAGGAATCCAAGAGAATCAACGCGGAGATCGAGAAGCAGCTGAGGAGGGACAAGAAAGACTCTCGGCGGGAGCTCAAATTGCTTTTGCTCGGTACTGGAGAGAGTGGAAAAAGCACATTCATTAAACAGATGAGGATTATTCATGGCTCTGGCTATTCTGAAGAAGACAAGAGGGGATTTACCAAGCTAGTTTTTCAGAATATCTTCACTGCCATGCAGTCTATGATAAGAGCCATGGATACACTAAAAATTCCCTACAAGTGTGAACAGAACAAGGCCAATGCTCAAGTAGTGCGAGAAGTGGACGTAGAGAAAGTATGTACCTTTGAACAGCCATATGTGAATGCAATCAAGAACCTGTGGAGTGACCCTGGGATCCAGGAGTGCTATGATCGACGGCGAGAGTACCAACTGTCAGATTCTGCCAAGTATTACCTGACAGATGTGGACCGGATTTCAAAACCCGGCTACCTGCCCACGCAACAAGATGTGCTGCGTGTAAGAGTGCCAACTACGGGTATAATAGAGTACCCTTTTGATTTGGAGAACATCATCTTCAGGATGGTAGATGTTGGTGGTCAGAGGTCTGAACGAAGGAAATGGATTCATTGCTTTGAGAATGTCACTTCCATCATGTTCCTTGTAGCCCTTAGTGAATATGACCAGGTTCTTGTGGAGTCTGATAATGAGAATCGGATGGAGGAGAGTAAGGCACTGTTCAGGACCATAATAACATACCCTTGGTTCCAAAATTCCTCTGTCATTCTGTTTCTAAATAAAAAGGATCTGCTGGAAGATAAGATCATGTATTCCCACCTCGTAGACTATTTTCCTGAATTTGATGGCCCTCAACGCGATGCTGCAACAGCTCGTGAGTTCATTTTGAAGATGTTTGTGGACCTGAATCCCGACAGTGACAAGATCATCTATTCGCACTTCACCTGTGCCACAGATACCGAAAACATACGCTTTGTCTTCGCTGCTGTCAAAGACACCATACTACAGCACAACCTTAAAGAGTACAACCTGGTGTAA
Full Trace Sequence: acggaatccccggacacagctaaacagggaggggagatttctgtacccgcccccttccttatgcacgtacggatgctcgacgatctgtgaaggggctcagaggccgggtagtgagtgagtgtctccccccgggtgggagaggcccccggtgcgggccacagtgccggggggaagggatgactctggattcaatgatggcctgctgcctgagcgaggaggtaaaggaatccaagagaatcaacgcggagatcgagaagcagctgaggagggacaagaaagactctcggcgggagctcaaattgcttttgctcggtactggagagagtggaaaaagcacattcattaaacagatgaggattattcatggctctggctattctgaagaagacaagaggggatttaccaagctagtttttcagaatatcttcactgccatgcagtctatgataagagccatggatacactaaaaattccctacaagtgtgaacagaacaaggccaatgctcaagtagtgcgagaagtggacgtagagaaagtatgtacctttgaacagccatatgtgaatgcaatcaagaacctgtggagtgaccctgggatccaggagtgctatgatcgacggcgagagtaccaactgtcagattctgccaagtattacctgacagatgtggaccggatttcaaaacccggctacctgcccacgcaacaagatgtgctgcgtgtaagagtgccaactacgggtataatagagtacccttttgatttggagaacatcatcttcaggatggtagatgttggtggtcagaggtctgaacgaaggaaatggattcattgctttgagaatgtcacttccatcatgttccttgtagcccttagtgaatatgaccaggttcttgtggagtctgataatgagaatcggatggaggagagtaaggcactgttcaggaccataataacatacccttggttccaaaattcctctgtcattctgtttctaaataaaaaggatctgctggaagataagatcatgtattcccacctcgtagactattttcctgaatttgatggccctcaacgcgatgctgcaacagctcgtgagttcattttgaagatgtttgtggacctgaatcccgacagtgacaagatcatctattcgcacttcacctgtgccacagataccgaaaacatacgctttgtcttcgctgctgtcaaagacaccatactacagcacaaccttaaagagtacaacctggtgtaaccaagcacccacctcccctcaacctcctccccttcattagaaagttggggtcagccccatcaccagaaagcaaagcactggtgtgagcgaaggggaggaggcttcagtcttgcttttgtttttattatctttttttattataattttattttgtttctaaatgggatgatttttgccaaattagtaaaggtgcagcttattgctgctccgtatgcctttgataagtcgttaaaaatcatgggtttatatttcaaatagcctcttaatatttcttgtattaaaacagtaagaagggcaaaaaaatgaaaaaaaaaaaaaaaaaaa
Translation: MTLDSMMACCLSEEVKESKRINAEIEKQLRRDKKDSRRELKLLLLGTGESGKSTFIKQMRIIHGSGYSEEDKRGFTKLVFQNIFTAMQSMIRAMDTLKIPYKCEQNKANAQVVREVDVEKVCTFEQPYVNAIKNLWSDPGIQECYDRRREYQLSDSAKYYLTDVDRISKPGYLPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEDKIMYSHLVDYFPEFDGPQRDAATAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQHNLKEYNLV
Donor tissue: gastrula