ORFeome > gnb2 – XORFeome 2.0

gnb2 – XORFeome 2.0

General Information

Species: Xenopus tropicalis guanine nucleotide binding protein (G protein), beta polypeptide 2, mRNA (cDNA clone MGC:89081 IMAGE:7006060), complete cds
Gene Symbol: gnb2
Gene ID: 448577
ORF gb_acc: MG134120
ORF ID: 11746

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC076910

Library Location

Plate ID: GDExt11017
Well Location: G08

EST Sequences

Clone: MGC:89081 IMAGE:7006060
Trimmed Sequence: ATGAGTGAACTAGATCAGCTACGCCAGGAGGCTGAGCAGCTCAAGAACCAAATCAGAGATGCAAGGAAAGCTTGTGCAGATGCCACTCTGGCTCAGATCACAGCCAACATTGATCCAGTTGGTCGAATTCAGATGCGCACTAGACGTACATTGAGAGGGCACCTGGCTAAAATCTATGCTATGCACTGGGGTACGGACTCCAGGCTGCTAGTTAGTGCCTCCCAGGACGGCAAGCTCATCATTTGGGATAGTTACACCACGAACAAGGTTCATGCCATCCCGCTGCGTTCTTCTTGGGTAATGACTTGTGCATATGCTCCCTCTGGAAACTATGTTGCCTGTGGTGGTCTTGATAACATCTGCTCTATTTACAACCTCAAAACTCGTGAAGGAAATGTGCGGGTGAGCCGTGAATTGGCTGGGCATACAGGGTATCTTTCCTGCTGCCGTTTTCTGGATGATAACCAAATAATTACCAGTTCTGGAGATACCACTTGTGCCCTTTGGGACATTGAAACTGGCCAGCAGACAACAACCTTTACTGGACACACTGGGGATGTTATGAGCCTGTCCTTAGCTCCAGATTCCAGGTGCTTCGTGTCTGGAGCCTGTGATGCATCTGCCAAACTTTGGGACATTCGAGAAGGAATGTGTAGACAAACCTTCACTGGACATGAGTCGGACATAAATGCCATCTGTTTCTTCCCCAATGGCAATGCTTTTGCCACTGGTTCAGATGATGCCACCTGCAGGCTGTTTGACCTTCGGGCTGACCAGGAACTGATGGTTTATTCACATGATAATATTATCTGTGGCATCACCTCTGTAGCATTCTCCAAGAGTGGACGCCTCCTCCTAGCTGGATATGATGACTTTAATTGCAATGTCTGGGACACACTTAAGGCTGATAGAGCTGGTGTTCTTGCTGGTCATGATAATCGTGTAAGTTGCTTGGGAGTAACAGATGATGGCATGGCAGTGGCAACAGGGTCATGGGACAGCTTCCTCAAGATCTGGAACTAA
Full Trace Sequence: ggtgtgagcgcgttggtattttggaggcagattggggagacggaagcagaaccaagccgcacgtcggggaatcagagagcacctttaccggagactgtggggaaagaagaagttgcagaaagaaaggccttgcgctaagcagccaccctcccttccgtcaccgcccagcacgtctcctgctcccctcatcctccccgtccccccacccctctccggccgcccttcacctctcacacgccctcctttcttgggacaagccgcggggcctctgggggaggagagggggaaacgattaaaacctaaggggggtcgcaccgatacagcgcccggagaggccccggtgggagaagaaaccgagtggtgcgaggagccgggtaccgcagctgggggggagccgtggatggtcacatcttcggagggcagaagaactgagtgttggtggtggtagagaagctccattttagggacgaaaatgagtgaactagatcagctacgccaggaggctgagcagctcaagaaccaaatcagagatgcaaggaaagcttgtgcagatgccactctggctcagatcacagccaacattgatccagttggtcgaattcagatgcgcactagacgtacattgagagggcacctggctaaaatctatgctatgcactggggtacggactccaggctgctagttagtgcctcccaggacggcaagctcatcatttgggatagttacaccacgaacaaggttcatgccatcccgctgcgttcttcttgggtaatgacttgtgcatatgctccctctggaaactatgttgcctgtggtggtcttgataacatctgctctatttacaacctcaaaactcgtgaaggaaatgtgcgggtgagccgtgaattggctgggcatacagggtatctttcctgctgccgttttctggatgataaccaaataattaccagttctggagataccacttgtgccctttgggacattgaaactggccagcagacaacaacctttactggacacactggggatgttatgagcctgtccttagctccagattccaggtgcttcgtgtctggagcctgtgatgcatctgccaaactttgggacattcgagaaggaatgtgtagacaaaccttcactggacatgagtcggacataaatgccatctgtttcttccccaatggcaatgcttttgccactggttcagatgatgccacctgcaggctgtttgaccttcgggctgaccaggaactgatggtttattcacatgataatattatctgtggcatcacctctgtagcattctccaagagtggacgcctcctcctagctggatatgatgactttaattgcaatgtctgggacacacttaaggctgatagagctggtgttcttgctggtcatgataatcgtgtaagttgcttgggagtaacagatgatggcatggcagtggcaacagggtcatgggacagcttcctcaagatctggaactaaaatactaagcgggcttctccgtgactggaagaccattccaaccttcaaaaattttaaatcatagcatatccgatccaaccatactaacgtggacaccctttctccctattcctatacatcaaagggcagaaaactctccccttattttgctgaaacgaagagcacaattatttgctataggaagatttgttttgttttgttttgttttggtctctgaaacagaattgttcattccttttgggaccgtttattccattattccctctttacttactttttttatttgattttctttctcttctctacatctcgtcttgaagattaatgatacaaaacactatacagtaaagacatacagttagctttgttaagcagaaagtgagtttcatgaaagtttacctgaaggtccttgataagtctgtccagattgccattttgtagagtctggtgcacttgcaggtatggaaaatctgcagctatataaaaacaaaaaggattttaaaatgagaagtttacttattgtggtttttattttttactttggtccattaagtgaaggtggaacttgagtctgtgtgtcaggacatactgttagccctgtccctgtagagtttcttgtgaaaacttgcacagaaagtggccaagttaataacacacaagtgtaaactatccacatgccctctattaaataacttcaatgggtaggttgctccagcgattgagttatttttgatggccaaatgctaggaaatggttataacacaatgcctggaatgccaatgtattgatagggccatttgagaattaaaagatccatttgataatggattgtgtctccaggctgcccagaacatggcaccattaataataaactgttccctgtacaccttaaccatatcctacacctcatcatatactaactcctctatgattgagaccatgcagaattgcagagcaatgtgccggagctcagtctgttcaggataatcccagaaacccccttaaagccagtaaagggtgctgcaagggttccaaccagaggaaaacatatttctttttttctctaagtatgtacatcatgaggatttgcacccgtatcaagcccagctaagcttatttgaggagtgtgaaagatccttattattttttgaatactaacctcttttcctgcggggattgaaggaaaatgatccccaaatgtaatgtagaggagtcttattggtgctttatgctcttatggttttcactttacagaaaaggaataaaaggatcgtttaccaagttattttaatgtttaatcaataccgaccttcactttctgaagcatgtcaaatccttatccacagaaccctgaataataacccaagttcctcctaaccaaacactggggaaaagaagttaaagagaaagggtaactttcacaagcgctaccctcgtcccatctcctagattagaatcaaccgtggacagaagtacatatctgttcgttcggatatacattcagatgtgtatgaaatgatgtacaaattaatgtttttgaaaataatgatcttgaactttctaagttaaatcttacgaaagcttttattcttttgttggcggggagggggggtgtgtttgccatagggatgggttttcctcttagggttgcatgctgtagagttgcttaataatgtgcaaatagaaaaaaaaagtccttagatgttttttttgttttttttttccttttaaagaaataacctgtttaaaaaaaaaaaaaaaaaa
Translation: MSELDQLRQEAEQLKNQIRDARKACADATLAQITANIDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDSRCFVSGACDASAKLWDIREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMVYSHDNIICGITSVAFSKSGRLLLAGYDDFNCNVWDTLKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
Donor tissue: