ORFeome > gng13 – XORFeome 2.0

gng13 – XORFeome 2.0

General Information

Species: Xenopus tropicalis guanine nucleotide binding protein (G protein), gamma 13, mRNA (cDNA clone MGC:89780 IMAGE:7027749), complete cds
Gene Symbol: gng13
Gene ID: 496437
ORF gb_acc: MG133145
ORF ID: 10587

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC082958

Library Location

Plate ID: GDExt11005
Well Location: H11

EST Sequences

Clone: MGC:89780 IMAGE:7027749
Trimmed Sequence: ATGGATGAAATGGATGCTCCACAGATGAAGAAGGAGGTAGAGAGTCTGAAGTACCAGCTGGCTTACAAGAGAGAGATGTGTTCCAAATCTATACCAGAGCTGCTAAAGTGGATCGAGGACGGCGTACCCAATGACCCCTTCCTGAATCCGGAGCTGATGAAGAATAACCCTTGGGTGGAAAGGGGAAAATGCAGCATACTGTAA
Full Trace Sequence: cccccagattctttgggaatcaggccaaaaaaagatttgaatgccgaagctcctgtccatgcaaatagagaaatcggctgagcatcagaaaggagaggcgaccccaaggcgttaggctcgtggcccccggcagtattctccaagggcttgtaccacttaactccgctacaatggatgaaatggatgctccacagatgaagaaggaggtagagagtctgaagtaccagctggcttacaagagagagatgtgttccaaatctataccagagctgctaaagtggatcgaggacggcgtacccaatgaccccttcctgaatccggagctgatgaagaataacccttgggtggaaaggggaaaatgcagcatactgtaaagcgctcgctcccgacccccccagcggtaccattacccatgtactctgaatgtacttaaatatataacaatattaggatatagataggaagctgctcggagagtttacattgctatttaacaaactgtatcaaataaagcggttgggggggctggtataatttgatcatctgggttttttcttttcaagaccaccataagccaggtcagtggatcaatgtggccctaaatctctaatatttaatctctagtttgagagttacagtagaaggtgacagaatacatttgagggggggggggcatacggttacaattgtatggcggcaataatccagatggggggggctttgtactatgcagaatataattctcggcctgctgtgggtaaatgcaaagcccactggctctaccctaccggcctatgcactaggtaatgcgttagaaggatactactagtattaattaccctactgattagccctaacggaatgctaccctcacagggcactatatagggcttacttggcttaataaagcctatcttgggcaagttgtccaggctcattttctctgaaatcgaatggaaatgggcagctggaagaaaatgctctctactacacccctaaatgcccaccctccctgagacacaatgaagtcacataactaataaaggcatcttgatgcagtaatagctgacaggctcacactcattttctaagtgagagagtaaggcagaaatactgctggtagaaatactgcccccttttgacaaaatgggtaactctacaagggagcaatccggtagggtaatgaatgattttagtgtccctttaagctttcttcaggttgatgtcaatactttaccagattaacccccatctcttctgtagcctttttacccctacaagtcagtttacccccatagacccttcctaatgagaaacttgaggtttttcttccttctcttaaatgtggctctttctaaggttgtgcttgacagagctaattttacttttcaaacatgtaaaggaaaaacaaaatgctttctaacaaatatatatatatttaaccgttaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MDEMDAPQMKKEVESLKYQLAYKREMCSKSIPELLKWIEDGVPNDPFLNPELMKNNPWVERGKCSIL
Donor tissue: