ORFeome > gpr160 – XORFeome 2.0

gpr160 – XORFeome 2.0

General Information

Species: Xenopus tropicalis G protein-coupled receptor 160, mRNA (cDNA clone MGC:76104 IMAGE:5308379), complete cds
Gene Symbol: gpr160
Gene ID: 394946
ORF gb_acc: MG132700
ORF ID: 9991

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064207

Library Location

Plate ID: GDExt11001
Well Location: F06

EST Sequences

Clone: MGC:76104 IMAGE:5308379
Trimmed Sequence: ATGGCCTACAAGATCCAAGAGATTAGTCTGACTTCTACTGAGAGCATGCCAGAGCTGGATGCAGGGGAGGGGCCTGTGGCCCTGGAGCCAGACATGGATGTACATCTTCTTGAGCCCAGCTGTATGCTGATACTGATCATCACTGGCAAGATCATATTGAACATTTTCATTTTTGGGGCCAGACATAGGAAAGTCCACACAAGCTTCCTGGGATGCTTCTGTGTCTCATTGGGTGTTTTGGACTTTGCCCTGTTGCTTACCATTTCGGTAATCCATTATTTTGAGGATTTTGCTATTCATGGCATAAGGTTCACTAACTATCACATCTGCCTGTTAACTCAAATCATATCCCATGCATATGGCATTTTGCACTATCCAGTGTTATTGACAGCAGGGCTAGATTATTACATTACTGTTGTCAAATCCGTTCATCTCCCTAGGTTTTGTCTCAGCTTCCTCCATGTCATACTTACCTTGCTCCTGTGGATGGCAGCACTGGCTTTTGCCCTTTATTCTTCTGTTCCTCCTCCAGCCCCAGAACTGTCCTCATTCCAGTGTACTTTTTACGTCAGCAGCCAGACTTACTATCTATCAGCCGCTGTGGTATTTGCCATTGTTCTGATTTTGGGAATCTGTTGCTTTGAAGTGGTGGCTTTTATAAAATCCATGAAGTTCATCTCCTTCACCAACAAGACTGTTTTGCTGTTTTCCTGTGGAGACGAGTGGCCAGTCCAAGGAACCAAACGTCTCTTTACTGCTCTTTTGTTCTCATTTCTGGGCACTTGGGCACCATTTGTCCTCCTTCAAATAATTCTCCTCATTTTGCATGCTCCGATCCCAGGGTACATGGACATGAATGTGGCTTGGCTTTATTTTATGAACAGCTTCCTTGTGGGAATGGCCTATGGCCTTAAGTATCCTCGCATTCACCTGACCAGAGAGACACTTTCCATAGACCCTTTCATCAGCTGGAAGTATTGCATTCTGCCTTTTATTGACATTGACTACAAAGTGGAGGATTTTTTAAAGGAGCAGTTACATCCAGTTATGATTGTTTAA
Full Trace Sequence: cgccgtttggttagttggcgctgtgctactcatgccgggccgacaccgtcttctaatgcgcttgggaatctgtcagaatgtgaagtcctgaggagacttacaggaggaagaaaagaggttgaaatgctgttgcctcctcatggcctacaagatccaagagattagtctgacttctactgagagcatgccagagctggatgcaggggaggggcctgtggccctggagccagacatggatgtacatcttcttgagcccagctgtatgctgatactgatcatcactggcaagatcatattgaacattttcatttttggggccagacataggaaagtccacacaagcttcctgggatgcttctgtgtctcattgggtgttttggactttgccctgttgcttaccatttcggtaatccattattttgaggattttgctattcatggcataaggttcactaactatcacatctgcctgttaactcaaatcatatcccatgcatatggcattttgcactatccagtgttattgacagcagggctagattattacattactgttgtcaaatccgttcatctccctaggttttgtctcagcttcctccatgtcatacttaccttgctcctgtggatggcagcactggcttttgccctttattcttctgttcctcctccagccccagaactgtcctcattccagtgtactttttacgtcagcagccagacttactatctatcagccgctgtggtatttgccattgttctgattttgggaatctgttgctttgaagtggtggcttttataaaatccatgaagttcatctccttcaccaacaagactgttttgctgttttcctgtggagacgagtggccagtccaaggaaccaaacgtctctttactgctcttttgttctcatttctgggcacttgggcaccatttgtcctccttcaaataattctcctcattttgcatgctccgatcccagggtacatggacatgaatgtggcttggctttattttatgaacagcttccttgtgggaatggcctatggccttaagtatcctcgcattcacctgaccagagagacactttccatagaccctttcatcagctggaagtattgcattctgccttttattgacattgactacaaagtggaggattttttaaaggagcagttacatccagttatgattgtttaaatcactgtgcgttccaggctatagactgtcagttttatgtgaaacaataaaactcctctcaggttcttttgtttactaaatgtttataagcatggtgtctgtacttaggtatattgtttatgccatacagaggaaactttcttttgctctttccatttgtttttctttaggggaaataaaggctcagtaaaaaaaacaaacaatgtaaataggcacaagacatcccctgagcatctttgctgtttttgtttaaggagtctgcaacttctgatcagaagccctgtgcatagggtgcccatgaaacagcatccctgtgcccagcgcagtgtttctcacctgtgcactttctaaatgggcatgattaatttgcttctctaatcatgccaatttgttttgtttttttcccaataatgttattgcctatttaaaaaaaaaaacaaaaaaaacaaaacactgttgccactaggaagcaatgacagggtattttgttatattttataggtgtgtcatgaactattgttgtttcatacaaaatgctataaaattaacttacttaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MAYKIQEISLTSTESMPELDAGEGPVALEPDMDVHLLEPSCMLILIITGKIILNIFIFGARHRKVHTSFLGCFCVSLGVLDFALLLTISVIHYFEDFAIHGIRFTNYHICLLTQIISHAYGILHYPVLLTAGLDYYITVVKSVHLPRFCLSFLHVILTLLLWMAALAFALYSSVPPPAPELSSFQCTFYVSSQTYYLSAAVVFAIVLILGICCFEVVAFIKSMKFISFTNKTVLLFSCGDEWPVQGTKRLFTALLFSFLGTWAPFVLLQIILLILHAPIPGYMDMNVAWLYFMNSFLVGMAYGLKYPRIHLTRETLSIDPFISWKYCILPFIDIDYKVEDFLKEQLHPVMIV
Donor tissue: gastrula