ORFeome > gyg1 – XORFeome 2.0

gyg1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis glycogenin 1, mRNA (cDNA clone MGC:76101 IMAGE:5308333), complete cds
Gene Symbol: gyg1
Gene ID: 394883
ORF gb_acc: MG132701
ORF ID: 9992

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064206

Library Location

Plate ID: GDExt11001
Well Location: E07

EST Sequences

Clone: MGC:76101 IMAGE:5308333
Trimmed Sequence: ATGGCTGCAGATCAAGCTTTTGTGACCCTGGCTACAAATGACACCTATGTAAAAGGAGCGCTGGTGTTGGGATCATCTCTGCGACAACACAACACTACAAACAAGCTGGTTGTGCTTATAACTCCTCAGGTCTCAGACGCCATGAGAAAAGTACTTGACAAAGTCTATGATGATGTTCGAGTGGTGGATGTCTTGGACAGTGGGGATTCTGCACACCTCGCTTTAATGAAACGACCTGAATTGGGAGTCACACTGACAAAAATACACTGTTGGACTCTTACAGAATATTCCAAATGCGTATTCATGGACGCAGACACCATGGTTTTGTGTAACATTGATGAGCTTTTTGAAAGAGAAGAGCTGTCTGCAGCACCGGACCCAGGCTGGCCTGACTGCTTCAACTCTGGAGTGTTTGTTTTTACACCATCTTTTGAAACCTACAATGATCTTCTACAGTTGGCAACACAAAAAGGCAGCTTTGATGGTGGGGACCAAGGATTGCTAAACACATTTTTTGATACTTGGGCCACAAAAGATATAAACAAGCATCTCCCCTTTGTGTACAACCTGAGCAGTGTCTCCTTGTACTCCTATCTTCCAGCATTCAAAGCATTTGGAGCCAATGCTAAGGTGGTGCATTTCCTGGGGAAGGTGAAGCCTTGGAACTATACGTACGACAGTAAAACAAAAAGCGTGAGGAGTGATGTACATGATCCATCTCTCATTCACCCAGAATTCCTCAACCTCTGGTGGGACATCTACTCTACTAAGATTGTCTCTCTGCTTACACAAGAAGGAGCTGTTAAAGAAGCAACAACTGCCCTACAAGTGGAGGAGGTTAAAGAAGCAGTGGTACAGATGTCCATTTCACATTCACATTCTCCTCCATCTGCATCTTCAGAAGAACGCCGGGAAAGATGGGAACAAGGCCAGGTGGATTACATGGGCGAAGACTCGTATGAAAACATCAAAAAGAAGCTTGACTCCTATCTCCAATAG
Full Trace Sequence: cagctgggtcaggggaggaggcaagagccagtccggaacagcacactccatcgctgcagagagcccgcagcagctccgacatggctgcagatcaagcttttgtgaccctggctacaaatgacacctatgtaaaaggagcgctggtgttgggatcatctctgcgacaacacaacactacaaacaagctggttgtgcttataactcctcaggtctcagacgccatgagaaaagtacttgacaaagtctatgatgatgttcgagtggtggatgtcttggacagtggggattctgcacacctcgctttaatgaaacgacctgaattgggagtcacactgacaaaaatacactgttggactcttacagaatattccaaatgcgtattcatggacgcagacaccatggttttgtgtaacattgatgagctttttgaaagagaagagctgtctgcagcaccggacccaggctggcctgactgcttcaactctggagtgtttgtttttacaccatcttttgaaacctacaatgatcttctacagttggcaacacaaaaaggcagctttgatggtggggaccaaggattgctaaacacattttttgatacttgggccacaaaagatataaacaagcatctcccctttgtgtacaacctgagcagtgtctccttgtactcctatcttccagcattcaaagcatttggagccaatgctaaggtggtgcatttcctggggaaggtgaagccttggaactatacgtacgacagtaaaacaaaaagcgtgaggagtgatgtacatgatccatctctcattcacccagaattcctcaacctctggtgggacatctactctactaagattgtctctctgcttacacaagaaggagctgttaaagaagcaacaactgccctacaagtggaggaggttaaagaagcagtggtacagatgtccatttcacattcacattctcctccatctgcatcttcagaagaacgccgggaaagatgggaacaaggccaggtggattacatgggcgaagactcgtatgaaaacatcaaaaagaagcttgactcctatctccaatagaacttcttctcttgcataaagaacatgttcaagagctattcattgtctaggacagcgttctatctactgtttacttaatgctaggagctttatgaagaccattttttttttcccactgtcagtgggaaagttaaaatgggtaaactgttacaaacccagttaatgtgccattttcccttttagctgtagctagagggtagaagtggctctaggtgatatgggattaatagttttagatctggtttgaaacttgaaaagtagcccctaagtggtaattttaacctcaacatgatttggcattgtgcaccttgcttaagcattagctaatgctcccgcgctgttccatgtgatccatcttggattgtacaggttgtgtaagcaatggcagtttgcttctccagggtacccacagttgtccttttgtccacatctgcaaactgtcagcatgaataagctgctcctaaatgccagactctgggagctgcaccaagtgcactgccaacacaccttggaatgcttcttgttcagttctgtagccaacaaggcacatgtactgtactacatttctctgaactaacatggcacttcagaaataaactgatcctgattcagtaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MAADQAFVTLATNDTYVKGALVLGSSLRQHNTTNKLVVLITPQVSDAMRKVLDKVYDDVRVVDVLDSGDSAHLALMKRPELGVTLTKIHCWTLTEYSKCVFMDADTMVLCNIDELFEREELSAAPDPGWPDCFNSGVFVFTPSFETYNDLLQLATQKGSFDGGDQGLLNTFFDTWATKDINKHLPFVYNLSSVSLYSYLPAFKAFGANAKVVHFLGKVKPWNYTYDSKTKSVRSDVHDPSLIHPEFLNLWWDIYSTKIVSLLTQEGAVKEATTALQVEEVKEAVVQMSISHSHSPPSASSEERRERWEQGQVDYMGEDSYENIKKKLDSYLQ
Donor tissue: gastrula