ORFeome > hadhsc – XORFeome 2.0

hadhsc – XORFeome 2.0

General Information

Species: Xenopus tropicalis L-3-hydroxyacyl-Coenzyme A dehydrogenase, short chain, mRNA (cDNA clone MGC:89260 IMAGE:6976586), complete cds
Gene Symbol: hadhsc
Gene ID: 496484
ORF gb_acc: MG134306
ORF ID: 11980

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC084457

Library Location

Plate ID: GDExt11019
Well Location: A01

EST Sequences

Clone: MGC:89260 IMAGE:6976586
Trimmed Sequence: ATGGCGTCCTCCTGCACAAGGCAGCTACTTGCGCGCTGCATGTCTTCATCTACGGCTGCAGCCAAGAAGCTCGCCATCAAACATGTGACAGTGATCGGAGGCGGCCTGATGGGAGCCGGGATAGCGCAGGTGGCTGCATCTACAGGTCACACAGTTGTGCTGGTTGATCAGACAGATGACATCCTAAAAAAGTCTAGAAAAACCATTGAAGACAGCTTGAAAAGAGTAACAAAGAAGATGTTTGCAGATAAGCCTGAGGCTGCCTCCCAGTTCATTGAAAAAATCCTTGCCAACTTTACAACCAGCACAGACCCAGCAGCTGTTGTGCACAGCACTGACCTTGTGGTTGAAGCCATTGTTGAGAATTTGGACGTGAAGAATGAGCTCTTCAAAAGACTAGATAAATTTGCCCCTGAACATACAATATTTGCTAGCAACACCTCATCATTGCCAATTACGGATATAGCAAATTCCACAACCAGGCAGGACCGGTTTGGTGGACTGCATTTCTTTAACCCTGTGCCAATGATGAAGCTTATTGAGGTCATAAAGACTCCAATGACAAGCCAAACAACCTTTGAGTCCCTGATGGATTTTAGTAAAGCTCTTGGAAAAACACCAGTGTCATGCAAGGACACCCCTGGCTTTATTGTTAACCGCCTCCTTGTGCCATACCTAATGGAATCTGTCAGACTTTATGAGCGAGGGCATGCATCAAAAGAAGACATTGATGTTGCAATGAAGCTTGGAGCAGGCTATCCCATGGGTCCTTTTGAGCTGCTGGATTACGTTGGCCTTGACACTAGTAAATACATTATTGATGGGTGGCATGCGTTGGAACCGAACAATCCGTTATTTGCGCCTAGTGAATTGTTAGATAAGCTGGTTGCTGAGAAGAAACTTGGCAAGAAGACGGGAGAAGGATTTTATAAATACAAATGA
Full Trace Sequence: gcgcttgcgtatgtccttcagagctttacattgactcgggcagacatggcgtcctcctgcacaaggcagctacttgcgcgctgcatgtcttcatctacggctgcagccaagaagctcgccatcaaacatgtgacagtgatcggaggcggcctgatgggagccgggatagcgcaggtggctgcatctacaggtcacacagttgtgctggttgatcagacagatgacatcctaaaaaagtctagaaaaaccattgaagacagcttgaaaagagtaacaaagaagatgtttgcagataagcctgaggctgcctcccagttcattgaaaaaatccttgccaactttacaaccagcacagacccagcagctgttgtgcacagcactgaccttgtggttgaagccattgttgagaatttggacgtgaagaatgagctcttcaaaagactagataaatttgcccctgaacatacaatatttgctagcaacacctcatcattgccaattacggatatagcaaattccacaaccaggcaggaccggtttggtggactgcatttctttaaccctgtgccaatgatgaagcttattgaggtcataaagactccaatgacaagccaaacaacctttgagtccctgatggattttagtaaagctcttggaaaaacaccagtgtcatgcaaggacacccctggctttattgttaaccgcctccttgtgccatacctaatggaatctgtcagactttatgagcgagggcatgcatcaaaagaagacattgatgttgcaatgaagcttggagcaggctatcccatgggtccttttgagctgctggattacgttggccttgacactagtaaatacattattgatgggtggcatgcgttggaaccgaacaatccgttatttgcgcctagtgaattgttagataagctggttgctgagaagaaacttggcaagaagacgggagaaggattttataaatacaaatgaaagtaatgccacacgctctattttgtaactgtccggcgactgtgggaggggaggtcaggtctgtcttgctaattaacacagaatagctgttgctctctcgctacataacggaaaattctattgatctgattttttgattcccatcgtatcactccgtagtgccttggagcaagggttgttcactgcggctcagaatccttttctaatgccttaaggaaaacttctaacaaacaactcatttgctgagttaataaatgtgactatgccagaaaaaaaaaaaaaaaaaaataaaaaaaaaaaaaaaaaaaa
Translation: MASSCTRQLLARCMSSSTAAAKKLAIKHVTVIGGGLMGAGIAQVAASTGHTVVLVDQTDDILKKSRKTIEDSLKRVTKKMFADKPEAASQFIEKILANFTTSTDPAAVVHSTDLVVEAIVENLDVKNELFKRLDKFAPEHTIFASNTSSLPITDIANSTTRQDRFGGLHFFNPVPMMKLIEVIKTPMTSQTTFESLMDFSKALGKTPVSCKDTPGFIVNRLLVPYLMESVRLYERGHASKEDIDVAMKLGAGYPMGPFELLDYVGLDTSKYIIDGWHALEPNNPLFAPSELLDKLVAEKKLGKKTGEGFYKYK
Donor tissue: tailbud