ORFeome > hdac2 – XORFeome 2.0

hdac2 – XORFeome 2.0

General Information

Species: Xenopus tropicalis histone deacetylase 2, mRNA (cDNA clone MGC:69271 IMAGE:5308345), complete cds
Gene Symbol: hdac2
Gene ID: 447995
ORF gb_acc: MG133193
ORF ID: 10656

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC074509

Library Location

Plate ID: GDExt11007
Well Location: D05

EST Sequences

Clone: MGC:69271 IMAGE:5308345
Trimmed Sequence: ATGGCGTACACTCAGGGGGGTGCCAAGAAGAAGGTCTGCTACTATTATGATGGGGATATCGGAAATTACTACTATGGCCAAGGGCATCCAATGAAGCCTCACAGAATCCGCATGACCCATAATTTGCTGCTGAACTATGGCCTTTATAGAAAAATGGAAATTTATCGACCTCACAAGGCAACAGCTGAAGAGATGACCAAGTATCACAGTGATGAATATATTAAATTTCTTCGATCGATACGACCAGACAATATGTCTGAATACAGCAAACAAATGCAGAGGTTTAACGTAGGTGAAGACTGTCCTGTGTTTGATGGCCTCTTTGAGTTTTGTCAGCTGTCTACTGGTGGTTCTGTAGCTGGTGCCGTAAAACTCAACCGGCAACAAACAGATATGGCTGTTAACTGGGCAGGGGGCCTTCATCATGCTAAGAAATCAGAAGCATCTGGATTTTGTTATGTGAATGATATTGTTCTTGCAATCCTTGAACTTCTGAAGTATCACCAAAGAGTGTTATATATTGATATTGATATCCATCATGGTGATGGTGTTGAAGAGGCATTTTATACCACCGATCGTGTCATGACAGTGTCATTTCACAAATATGGCGAATACTTCCCTGGCACTGGAGATCTTAGGGATATTGGTGCAGGAAAAGGTAAATATTATGCTGTCAATTTTCCAATGAGGGATGGGATTGATGATGAGTCTTATGGACAAATCTTTAAGCCGATAATTTCTAAAGTAATGGAGATGTACCAGCCCAGTGCTGTTGTTCTGCAGTGTGGTGCAGACTCTCTTTCTGGTGACCGTCTTGGATGCTTCAATCTGACTGTAAAAGGTCATGCAAAGTGTGTAGAAGTGGTGAAAACATTTAATTTGCCTTTGTTGATGCTTGGGGGAGGTGGATACACAATACGCAATGTTGCTCGATGCTGGACATATGAGACTGCTGTTGCACTGGACTGTGAAATCCCAAATGAATTGCCGTACAATGATTACTTTGAATATTTTGGACCTGACTTCAAGCTACATATTAGCCCTTCTAATATGACAAATCAAAATACTCCTGAATATATGGAAAAAATAAAGCAGCGCTTGTTTGAAAACTTGCGTATGCTGCCTCATGCTCCTGGAGTACAGATGCAGGCTATTCCAGAGGATGCTGTACAGGAGGACAGTGGTGATGAGGAAGGAGAAGACCCAGACAAGCGCATTTCCATACGAGCTTCTGACAAGCGCATAGCCTGCGATGAGGAGTTTTCAGATTCAGAGGATGAAGGTGAAGGAGGAAGACGTAACGTAGCAGATCACAAAAAGGGAGCAAAAAAAGCAAGACTTGAAGAAGAGAAAAAAGAAACAGATGACAAGAAATCTGATGTTAAAGAAGAGGATAAATCCAAGGACAACATTGCAGAGAAAATGGACACAAAAGGTGTTAAGTCTGAACAACCAAGTAATCCGTGA
Full Trace Sequence: gtctgtgtgagcctgagcgcgccccccggccgagcgggaaaagtctcattgagcaccgaataacggcagccgtgtactcacagcagcttctttcgctcccaatcggtgccccgaccggaccgcttccgcgcctctataccgctttatccgatcttttggcgcaagagtagtccgtgcactgtgcaagggggctccatggcgtacactcaggggggtgccaagaagaaggtctgctactattatgatggggatatcggaaattactactatggccaagggcatccaatgaagcctcacagaatccgcatgacccataatttgctgctgaactatggcctttatagaaaaatggaaatttatcgacctcacaaggcaacagctgaagagatgaccaagtatcacagtgatgaatatattaaatttcttcgatcgatacgaccagacaatatgtctgaatacagcaaacaaatgcagaggtttaacgtaggtgaagactgtcctgtgtttgatggcctctttgagttttgtcagctgtctactggtggttctgtagctggtgccgtaaaactcaaccggcaacaaacagatatggctgttaactgggcagggggccttcatcatgctaagaaatcagaagcatctggattttgttatgtgaatgatattgttcttgcaatccttgaacttctgaagtatcaccaaagagtgttatatattgatattgatatccatcatggtgatggtgttgaagaggcattttataccaccgatcgtgtcatgacagtgtcatttcacaaatatggcgaatacttccctggcactggagatcttagggatattggtgcaggaaaaggtaaatattatgctgtcaattttccaatgagggatgggattgatgatgagtcttatggacaaatctttaagccgataatttctaaagtaatggagatgtaccagcccagtgctgttgttctgcagtgtggtgcagactctctttctggtgaccgtcttggatgcttcaatctgactgtaaaaggtcatgcaaagtgtgtagaagtggtgaaaacatttaatttgcctttgttgatgcttgggggaggtggatacacaatacgcaatgttgctcgatgctggacatatgagactgctgttgcactggactgtgaaatcccaaatgaattgccgtacaatgattactttgaatattttggacctgacttcaagctacatattagcccttctaatatgacaaatcaaaatactcctgaatatatggaaaaaataaagcagcgcttgtttgaaaacttgcgtatgctgcctcatgctcctggagtacagatgcaggctattccagaggatgctgtacaggaggacagtggtgatgaggaaggagaagacccagacaagcgcatttccatacgagcttctgacaagcgcatagcctgcgatgaggagttttcagattcagaggatgaaggtgaaggaggaagacgtaacgtagcagatcacaaaaagggagcaaaaaaagcaagacttgaagaagagaaaaaagaaacagatgacaagaaatctgatgttaaagaagaggataaatccaaggacaacattgcagagaaaatggacacaaaaggtgttaagtctgaacaaccaagtaatccgtgatctgttggaaagaggaactttgatggcaggatgccgcaataaaaggtggaagtagagttaatccccaacccccttaaaaaagactgctgattataccctctagcacttggcatggaccgtatttattgtaaaacggtattgtttttttttgttttgtttgtttgttttttctggcaggtcgtaatgcattttttaattatggagcaaaatttcttatctttgccatgctttatgtattagtatttaagtaaacgtgagttatgtttcatgtcttaaactgatctattaaaatgcctttttgcctttaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MAYTQGGAKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVQEDSGDEEGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARLEEEKKETDDKKSDVKEEDKSKDNIAEKMDTKGVKSEQPSNP
Donor tissue: gastrula