ORFeome > hnrpa0 – XORFeome 2.0

hnrpa0 – XORFeome 2.0

General Information

Species: Xenopus tropicalis heterogeneous nuclear ribonucleoprotein A0, mRNA (cDNA clone MGC:75874 IMAGE:5383027), complete cds
Gene Symbol: hnrpa0
Gene ID: 394519
ORF gb_acc: MG132991
ORF ID: 10374

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC059760

Library Location

Plate ID: GDExt11004
Well Location: B09

EST Sequences

Clone: MGC:75874 IMAGE:5383027
Trimmed Sequence: ATGAGTACCGGCGATATGGATACGACGCAACTCTGCAAACTGTTTATCGGGGGGCTTAACGTGCAGACCACCGAAGAGGGCCTACGCCAGCATTTTGAGACCTACGGTCAACTGACGGACTGCGTGGTGGTTATCAACCCACAGACCAAGCGGTCTCGATGTTTCGGTTTCGTAACCTACTCGAGTGCCGCGGAGGCCGACGCGGCGGTGGAGGCCTCGCCCCACGTGGTTGACGGTAACAACGTTGAGCTGAAGCGGGCCGTCTCCAGGGAAGATTCCGCCAAGCCGGGGGCACACGCTAAAGTGAAGAAGCTCTTTGTTGGCGGCCTGAAAGAGGACGTCGGCGAGAGTGACTTGCTCGAACACTTCGCCCAGTTTGGCGCCGTGGAAAAAGTGGAGATCATTGCCGATAAAGTGTCCGGCAAGAAACGCGGCTTCGGCTTTGTGTACTTTACCAACCACGATTCCGCCGACAAGGCCGCGGTGGTCAAGTTCCACTCCATCAACGGGCACCGCGTCGAGGTAAAGAAGGCCGTGCCCAAGGAGGAACTTTCCCAGGGTTCCAATAGATCCTTCCGCGGCGGCAGGGGCGGGAGAGGCCGAGGTGGCGGCGGAGCGCCCCGGGACTACAATGGCATCCCTGGAAGTGGCGGCAAAGCTGCTTTCGGTGGGGGCTACGGCGGCTATGGGGGCGGCAACCAGGGCTACGGCTCGTACGGAGGCGGCTATGGCGAGCAGAGCGACTACGGCAATGGCTACAACAGTTTCGGGAGCTACAGCCAGCACCAGTCCTCGTACGGGCCCATGAAGGGAGCGGGAAGCGGCAGCTGGAACCGGCCCAACACGTCAGGCCCCTACCGCGGAGGTTATAGCGGCGGCGGAGGAGGAGGTTATGGCGTCGGCAGCTCCTATGGCGGCGGCTCCTTCTGA
Full Trace Sequence: ctgtgcttgcgtttcaatgagtaccggcgatatggatacgacgcaactctgcaaactgtttatcggggggcttaacgtgcagaccaccgaagagggcctacgccagcattttgagacctacggtcaactgacggactgcgtggtggttatcaacccacagaccaagcggtctcgatgtttcggtttcgtaacctactcgagtgccgcggaggccgacgcggcggtggaggcctcgccccacgtggttgacggtaacaacgttgagctgaagcgggccgtctccagggaagattccgccaagccgggggcacacgctaaagtgaagaagctctttgttggcggcctgaaagaggacgtcggcgagagtgacttgctcgaacacttcgcccagtttggcgccgtggaaaaagtggagatcattgccgataaagtgtccggcaagaaacgcggcttcggctttgtgtactttaccaaccacgattccgccgacaaggccgcggtggtcaagttccactccatcaacgggcaccgcgtcgaggtaaagaaggccgtgcccaaggaggaactttcccagggttccaatagatccttccgcggcggcaggggcgggagaggccgaggtggcggcggagcgccccgggactacaatggcatccctggaagtggcggcaaagctgctttcggtgggggctacggcggctatgggggcggcaaccagggctacggctcgtacggaggcggctatggcgagcagagcgactacggcaatggctacaacagtttcgggagctacagccagcaccagtcctcgtacgggcccatgaagggagcgggaagcggcagctggaaccggcccaacacgtcaggcccctaccgcggaggttatagcggcggcggaggaggaggttatggcgtcggcagctcctatggcggcggctccttctgaaaggtttaataactttggcgcagtgagagatggaaataatccacacaaacaccgataaactcgaacttctttcatattttcatgtgtgttttgggctctgattgtttttatactattgtaacctgagatctagagcgggaaactgacaatggcagttacggaagccgtattctcccacacccaccctggttttttgtttttggccagcctgttgggctgctgcaagcaaacagtaccccctgtacccttttttgtttttactttttaaataaatcggtttattacccactttgttcccctaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSTGDMDTTQLCKLFIGGLNVQTTEEGLRQHFETYGQLTDCVVVINPQTKRSRCFGFVTYSSAAEADAAVEASPHVVDGNNVELKRAVSREDSAKPGAHAKVKKLFVGGLKEDVGESDLLEHFAQFGAVEKVEIIADKVSGKKRGFGFVYFTNHDSADKAAVVKFHSINGHRVEVKKAVPKEELSQGSNRSFRGGRGGRGRGGGGAPRDYNGIPGSGGKAAFGGGYGGYGGGNQGYGSYGGGYGEQSDYGNGYNSFGSYSQHQSSYGPMKGAGSGSWNRPNTSGPYRGGYSGGGGGGYGVGSSYGGGSF
Donor tissue: neurula