ORFeome > hprt1 – XORFeome 2.0

hprt1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypoxanthine phosphoribosyltransferase 1, mRNA (cDNA clone MGC:76223 IMAGE:5336463), complete cds
Gene Symbol: hprt1
Gene ID: 394936
ORF gb_acc: MG132807
ORF ID: 10152

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064242

Library Location

Plate ID: GDExt11002
Well Location: B07

EST Sequences

Clone: MGC:76223 IMAGE:5336463
Trimmed Sequence: ATGGCGAGTCCCTGCATTGTGATTCAGGATGATGAGCAAGGATATGATCTTGATTTATTCTGCATTCCTAAACATTACGCAGCTGATCTGGAGAAAGTCTACATTCCACATGGTCTTATAATGGACAGGACTGAAAGGCTGGCTCGAGATATAATGAAAGACATGGGAGGTCACCACATTGTAGCATTGTGTGTACTGAAGGGTGGCTATAAGTTCTTCGCTGATCTACTTGACTACATTAAAGCACTTAACCGCAACAGTGACAAGTCTATCCCTATGACAGTAGATTTTATCAGACTGAAAAGTTACTGTAATGATCAATCAACGGGAGACATAAAGGTTATTGGAGGGGATGACCTCTCCACCTTGACAGGCAAGAATGTTTTGATTGTTGAGGATATAATTGATACTGGAAAAACAATGAAGACTTTGCTTGCTATGCTCAAGAAGTACAACCCAAAAATGGTTAAAGTAGCCAGCTTGCTTGTAAAAAGAACGCCACGAAGTGTGGGATACAGGCCAGACTTTGTTGGATTTGAGGTGCCAGACAAATTTGTTGTTGGTTACGCATTAGACTACAACGAGTACTTCAGAGACCTGAACCATATCTGTGTGATAAGTGAAGATGGTAAAGAAAAATACAAAACATAG
Full Trace Sequence: gtgtccctcgcaggttggacacaggctcagacatggcgagtccctgcattgtgattcaggatgatgagcaaggatatgatcttgatttattctgcattcctaaacattacgcagctgatctggagaaagtctacattccacatggtcttataatggacaggactgaaaggctggctcgagatataatgaaagacatgggaggtcaccacattgtagcattgtgtgtactgaagggtggctataagttcttcgctgatctacttgactacattaaagcacttaaccgcaacagtgacaagtctatccctatgacagtagattttatcagactgaaaagttactgtaatgatcaatcaacgggagacataaaggttattggaggggatgacctctccaccttgacaggcaagaatgttttgattgttgaggatataattgatactggaaaaacaatgaagactttgcttgctatgctcaagaagtacaacccaaaaatggttaaagtagccagcttgcttgtaaaaagaacgccacgaagtgtgggatacaggccagactttgttggatttgaggtgccagacaaatttgttgttggttacgcattagactacaacgagtacttcagagacctgaaccatatctgtgtgataagtgaagatggtaaagaaaaatacaaaacatagacagaacctctggaattgtctgtttgccagctttttacagtaaataatggatttgctgccattcgcccccagaaacctgtttgctttgtatctcagaccccttcctgcatgaaagaaattacagctttctccagaagtttggctatagatttctatacattgtttttttaagtttcacatattgtatttcgagacaacataaatgttgtatcagaatttagcatgttaatgaccttcaaagtagaagcccgcaggacaccgcagcacattacattaatggtcctttaaaaaggctgggtcaaatttaatatctggggacttgtaaaggaatgtttagttatgcaaaaaaaaaaaaaaaaaaaacagcattacaaaatgatttagctagtagctaggctactgcctgtctgtgtgatggccacgttgtaatataacttttttttttctgctagttttgtattaaatttgtattagaatccaaaaatttaaattggcttcattagtgaataacatggggtttaaatagattttacatgttttatttcaacggaattctgatgttcattgcagaaaaatattccattacaagtcctatgcctatgtggttaaagtgggctctaatacttgaatactcccggggggaatcttactgattgctctctgccagtacactgttctgatatagagtatatgattggaacttcctgtaggcttctatttttttaaatgtgcataatttatttttttatatatatataaataaatgatttttagttctggtgtctagctgcccttagtgataaaggtttagggaagcaacttgattaagactttattgcctatttcttgttattaaatagtaggaattctttaaaacacaaaaaaaaaaaaaaaaaaaaaa
Translation: MASPCIVIQDDEQGYDLDLFCIPKHYAADLEKVYIPHGLIMDRTERLARDIMKDMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDKSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMKTLLAMLKKYNPKMVKVASLLVKRTPRSVGYRPDFVGFEVPDKFVVGYALDYNEYFRDLNHICVISEDGKEKYKT
Donor tissue: tailbud