ORFeome > hsp105 – XORFeome 2.0

hsp105 – XORFeome 2.0

General Information

Species: Xenopus tropicalis heat shock protein 105, mRNA (cDNA clone MGC:75864 IMAGE:5382895), complete cds
Gene Symbol: hsp105
Gene ID: 394775
ORF gb_acc: MG133028
ORF ID: 10418

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC063346

Library Location

Plate ID: GDExt11004
Well Location: C06

EST Sequences

Clone: MGC:75864 IMAGE:5382895
Trimmed Sequence: ATGTCGGTTGTCGGGTTCGACCTCGGTTATCAGAACTGTCACGTCGCTATAGCCCGGTCCGGCGGTATCGAGACAGTAGCCAATGAATTCAGCGACCGATGCACCCCTGCTGTGGTATCATTTGGATTGAAAAACAGGACAATTGGCATTGCTGCCAAAAATCAGCTGATCACAAATGCCAACAACACTGTATCCAGCTTTAAGAAATTCCATGGCCGTGCATTCAGTGATGCATTTGTACAGAAAGAGAAAAATAATATGCCCTACAAGCTGGTACAAATGAATAACGGTGGCGTTGGTGTTAAGGTTAATTATCTGGAAGAAGAAAACGTATTTAGCATTGCACAGATAACCGCCATGCTGCTAACTAAGTTAAAGGAGACTGCAGAGTACAACCTCAAGAAACCAGTGACTGACTGTGTCCTATCTGTACCATCCTTCTTCACGGATGCAGAGAGGAGATCTGTTTTGGATGCTGCCCAGATTGTTGGCCTTAACTGCCTGAAGTTAATGAACGACATGACAGCAGTTGCTTTAAACTATGGAATATATAAGCAGGACCTTCCAGCTCCAGAGGAGAAACCTAAAATTGTGGTTTTTGCTGACATGGGACACTCCTCTTTCCAGTTATCTGCCTGTGCCTTCAACAAAGGCAAGCTAAAGGTTCTCGGCACAGCCTTCGACCCTTACTTGGGAGGAAAAAGTTTTGATGAAAAGCTTGTTGAACACTTTTGCACAGAATTTAAAACAAAATACAAGCTGGATGTGAAATCCAAAATCCGAGCCCTCCTGCGTCTCTATCAAGAATGTGAAAAGCTGAAGAAACTAATGAGCAGCAACAGCACAGATCTGCCACTAAATATTGAATGCTTTATGAATGACCTGGATGTTTCAGGGCGTATGAACAGGGCTGAATTTGAAGCTTTGTGTTCTGACCTCCTGCAAAGAATAGAAGCTCCTCTTCGCTCATTAATGGAGCAGACACAGTTACGTGCTGAAGATGTCTCTGCAGTGGAGGTCATTGGGGGCGCTACGCGAATTCCAGCTGTGAAGGAGAGGATTGCTAAGTTCTTCGGGAAGGATGTCAGCACAACGTTAAACGCAGATGAAGCCGTTGCACGAGGCTGTGCTCTGCAGGTGGTTATTTAA
Full Trace Sequence: gcctcctcccccacacgctgaatcacacagggacagcagcgcttcagtctgtggatcgccgcggatactcggaaccaaagcgggctgactgcctagtacttacccaaactgcggctccaaccggagactttgcccttatttccaacagctccgccgctgcagccttgcgggtcttatcatgtcggttgtcgggttcgacctcggttatcagaactgtcacgtcgctatagcccggtccggcggtatcgagacagtagccaatgaattcagcgaccgatgcacccctgctgtggtatcatttggattgaaaaacaggacaattggcattgctgccaaaaatcagctgatcacaaatgccaacaacactgtatccagctttaagaaattccatggccgtgcattcagtgatgcatttgtacagaaagagaaaaataatatgccctacaagctggtacaaatgaataacggtggcgttggtgttaaggttaattatctggaagaagaaaacgtatttagcattgcacagataaccgccatgctgctaactaagttaaaggagactgcagagtacaacctcaagaaaccagtgactgactgtgtcctatctgtaccatccttcttcacggatgcagagaggagatctgttttggatgctgcccagattgttggccttaactgcctgaagttaatgaacgacatgacagcagttgctttaaactatggaatatataagcaggaccttccagctccagaggagaaacctaaaattgtggtttttgctgacatgggacactcctctttccagttatctgcctgtgccttcaacaaaggcaagctaaaggttctcggcacagccttcgacccttacttgggaggaaaaagttttgatgaaaagcttgttgaacacttttgcacagaatttaaaacaaaatacaagctggatgtgaaatccaaaatccgagccctcctgcgtctctatcaagaatgtgaaaagctgaagaaactaatgagcagcaacagcacagatctgccactaaatattgaatgctttatgaatgacctggatgtttcagggcgtatgaacagggctgaatttgaagctttgtgttctgacctcctgcaaagaatagaagctcctcttcgctcattaatggagcagacacagttacgtgctgaagatgtctctgcagtggaggtcattgggggcgctacgcgaattccagctgtgaaggagaggattgctaagttcttcgggaaggatgtcagcacaacgttaaacgcagatgaagccgttgcacgaggctgtgctctgcaggtggttatttaaggataaaggaacactgttagcaatagaaaatggttttgatttagcttgatttggtgagactgaaacctaatcgtatttctcacatacttgaattgttgtaatatctgttcccatttaaatagaactctggctagggtgtaggaatggtttattaaagagatactgaccccagaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSVVGFDLGYQNCHVAIARSGGIETVANEFSDRCTPAVVSFGLKNRTIGIAAKNQLITNANNTVSSFKKFHGRAFSDAFVQKEKNNMPYKLVQMNNGGVGVKVNYLEEENVFSIAQITAMLLTKLKETAEYNLKKPVTDCVLSVPSFFTDAERRSVLDAAQIVGLNCLKLMNDMTAVALNYGIYKQDLPAPEEKPKIVVFADMGHSSFQLSACAFNKGKLKVLGTAFDPYLGGKSFDEKLVEHFCTEFKTKYKLDVKSKIRALLRLYQECEKLKKLMSSNSTDLPLNIECFMNDLDVSGRMNRAEFEALCSDLLQRIEAPLRSLMEQTQLRAEDVSAVEVIGGATRIPAVKERIAKFFGKDVSTTLNADEAVARGCALQVVI
Donor tissue: neurula