ORFeome > ier5l – XORFeome 2.0

ier5l – XORFeome 2.0

General Information

Species: Xenopus tropicalis Immediate early response gene 5-like protein, mRNA (cDNA clone MGC:75980 IMAGE:5384321), complete cds
Gene Symbol: ier5l
Gene ID: 394483
ORF gb_acc: MG133013
ORF ID: 10400

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC059766

Library Location

Plate ID: GDExt11004
Well Location: A11

EST Sequences

Clone: MGC:75980 IMAGE:5384321
Trimmed Sequence: ATGGAGTGCGCCCTGGACGCGCAGAGTCTGATCAGCTTATCCCTACGTAAGATCCACAGTTCCCGCACTCAGAGAGGTGGCATCAAGCTGCACAAAAACCTGCTGGTGTCCTACGTGCTGCGCAACGCCCGACAGCTCTACCTGAGTGAGCGCTACGCCGAGCTCTACCGCCGCCAGCCCTTCCCGCAGCCCATGGAAGAGTGCGGCGCCTGTGACGAGCCGGACATCCCGGAGCTGAGCCCCTTACAGATCCCGGAGGAAGGAGAGGACGAGATGCACCAACTGCCCAGGATACAGAACGGAGCCGAACTGCTGGAACCGCTAAGTTCCGAGGAACCGCTGGAGCTGCCACCCTGTGCGCACAGCCCGCACCCGGCCAAGGATCCCCACTCCGGCTTCTACTCTCCTGCCCCTTCCCGGGGCTTTTGCTCCTCCGGGGACAGCGGGGGCCTTGGGCTGCCCCAATGCAGTCACACCACCGTGTTGGACTTGGACACTCACGTTGTGACCACGGTGGAGAGTGGCTACTTGCACCAGGACTGTCCGTGCCAAGGCGCACCGCGCCCTGCGCTCCTCACCGCGCCTCCCAAGCGCAAATACGCCCCGGCGGGGTACAGCTACAGCGGCCATGGGGTGGCGGAGGAAGAGGAGGACGTGGAGCCCCACTTTGTGCCCTGCAAGCGGGGCAGATATGAGGACTTTTGCCCGCAGCCTTTGGGGGAACCCACGGACTCTAACAACATTTCCAACCTGATCTCCATCTTCGGCTCCGGCTTCTCGGGGCTCATGAGCCGGCAGAGCGAAGCGGAACAGAGCCTGAACGGACACTTGTGCGGGAAACAGGCGCTGGCGAGCCTGGGAGCCTGGACTAGAGCCATTGTGGCTTTCTAG
Full Trace Sequence: ggcagaggcacagagcggtagggacgctacagaggcgcctgagcctggagctccacttcccggtgtagagcgatcacccccccggagcaggaggctgctggaggccggtacagcatggagtgcgccctggacgcgcagagtctgatcagcttatccctacgtaagatccacagttcccgcactcagagaggtggcatcaagctgcacaaaaacctgctggtgtcctacgtgctgcgcaacgcccgacagctctacctgagtgagcgctacgccgagctctaccgccgccagcccttcccgcagcccatggaagagtgcggcgcctgtgacgagccggacatcccggagctgagccccttacagatcccggaggaaggagaggacgagatgcaccaactgcccaggatacagaacggagccgaactgctggaaccgctaagttccgaggaaccgctggagctgccaccctgtgcgcacagcccgcacccggccaaggatccccactccggcttctactctcctgccccttcccggggcttttgctcctccggggacagcgggggccttgggctgccccaatgcagtcacaccaccgtgttggacttggacactcacgttgtgaccacggtggagagtggctacttgcaccaggactgtccgtgccaaggcgcaccgcgccctgcgctcctcaccgcgcctcccaagcgcaaatacgccccggcggggtacagctacagcggccatggggtggcggaggaagaggaggacgtggagccccactttgtgccctgcaagcggggcagatatgaggacttttgcccgcagcctttgggggaacccacggactctaacaacatttccaacctgatctccatcttcggctccggcttctcggggctcatgagccggcagagcgaagcggaacagagcctgaacggacacttgtgcgggaaacaggcgctggcgagcctgggagcctggactagagccattgtggctttctagcaccccctaatacccctcaactgaccctctcctccgtatcaacaacacccccacagggaaagacttttttttatcaagaagagggattggggggggggcactgaattcaggacttgaatagaaatcacaaaaagacaatgttttatagagaaaaaagtgtacaaaattctacaaatgtttggactttatttttgcaaagaaagaaaaaaagcacctatttaattgaaaaaaaaaaaaaaaaaaaa
Translation: MECALDAQSLISLSLRKIHSSRTQRGGIKLHKNLLVSYVLRNARQLYLSERYAELYRRQPFPQPMEECGACDEPDIPELSPLQIPEEGEDEMHQLPRIQNGAELLEPLSSEEPLELPPCAHSPHPAKDPHSGFYSPAPSRGFCSSGDSGGLGLPQCSHTTVLDLDTHVVTTVESGYLHQDCPCQGAPRPALLTAPPKRKYAPAGYSYSGHGVAEEEEDVEPHFVPCKRGRYEDFCPQPLGEPTDSNNISNLISIFGSGFSGLMSRQSEAEQSLNGHLCGKQALASLGAWTRAIVAF
Donor tissue: neurula