ORFeome > il17b – XORFeome 2.0

il17b – XORFeome 2.0

General Information

Species: Xenopus tropicalis interleukin 17B, mRNA (cDNA clone MGC:89153 IMAGE:7015980), complete cds
Gene Symbol: il17b
Gene ID: 448327
ORF gb_acc: MG134187
ORF ID: 11832

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC075405

Library Location

Plate ID: GDExt11018
Well Location: E08

EST Sequences

Clone: MGC:89153 IMAGE:7015980
Trimmed Sequence: ATGTTTGGCTCCCATAGACTGTTCCTTTTGATAGCAACTTCCCTACTTGTGGCTCACGCCCTCAGCTCAGACACTCCAAATCCTTCAAAAGGCAGAAAAAAAGGTCACTTGAAAGGAAAAAATACTCACGGAACTGCTCAGGACAGAGCAAAGGGCAAAGCTTCCCCTGATCCAGTGTTAGGAGGAAACTCCTTTGCTCCATCACAGTTATATAGTTTGGTGGAGGATTATGAGCAGAGCCTCATGGAAATGGTGAACCAGCTGAGGAACAACTCTGATGTATCTGCGAATCGTTGCGAAGTCAGTCTGAGACTTTGGCTTTCTAACAGGAGAAGCCTTTCCCCCTGGGCCTACAGTATAAATCACGATGAAAATCGCATTCCAATTGATATTCCAGAAGCACGGTGCCTATGCACAGGCTGTGTTAACCCTTTCACCATGAAGGAGGATTTCAGTATGACGAGTATACCCATCTACAGCAAGATCCCTGTGCGGAGGCGACTGTGCGAGGGTAGCAGCTCTCCAATCAGGGCGCGGAGAAGGAAGAAGTGCCACAAAGAGTACATGGCTGTCATGGAGAACATAGCTGTGGGCTGCACCTGTATATTCTAA
Full Trace Sequence: ggaccaacctggcttttgttacctttgtattcagtacttttaaaataaaacaaaatcaaaagaagtgattggatgcagccctgccccattacaggcactctctaaaggtgaatttcatgccctcgcacactgggaatatattttgtggcagctggagaagccttcccttgagcttggaagccctgcaggtttcacaatgtttggctcccatagactgttccttttgatagcaacttccctacttgtggctcacgccctcagctcagacactccaaatccttcaaaaggcagaaaaaaaggtcacttgaaaggaaaaaatactcacggaactgctcaggacagagcaaagggcaaagcttcccctgatccagtgttaggaggaaactcctttgctccatcacagttatatagtttggtggaggattatgagcagagcctcatggaaatggtgaaccagctgaggaacaactctgatgtatctgcgaatcgttgcgaagtcagtctgagactttggctttctaacaggagaagcctttccccctgggcctacagtataaatcacgatgaaaatcgcattccaattgatattccagaagcacggtgcctatgcacaggctgtgttaaccctttcaccatgaaggaggatttcagtatgacgagtatacccatctacagcaagatccctgtgcggaggcgactgtgcgagggtagcagctctccaatcagggcgcggagaaggaagaagtgccacaaagagtacatggctgtcatggagaacatagctgtgggctgcacctgtatattctaagagcttctctctctcttttgaatttgcactacagttctttataccagaattacacagcacccacattcctacaatagacttgatgccactggcacagtccagcacatacacacaacataaaccaggaaagcacagctttggctttcatcaggcatgtgccaatgcacagagtaacttttttctctaaaacatgcctggtgatgtaccaagagcgtgccaggccccccagcaaaacaaatcttcagaggggccaagcgcacgcaggtacctagctgccactaccctccccacttgctctaacatacagccgtaccctgtgcagtgggtgcgcataaatctggccagacccagtggtctgtgcccccgtctgcttcctctacagttacaccacttaatgtgtcccttagccatgttttatacacagaggcacctgtgcagcaggccacaagctgctttgtctgcttagagctacttttgtgtttttgtttctttcatccagcaaaagtttaggtttgtaatgtaacagatgtttgtgttagcaaagcctcccactggcatcaagcctgttatatatgattcaccttcatccaaaataaagtcttaattcaataaaaccaagttacaagtgaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MFGSHRLFLLIATSLLVAHALSSDTPNPSKGRKKGHLKGKNTHGTAQDRAKGKASPDPVLGGNSFAPSQLYSLVEDYEQSLMEMVNQLRNNSDVSANRCEVSLRLWLSNRRSLSPWAYSINHDENRIPIDIPEARCLCTGCVNPFTMKEDFSMTSIPIYSKIPVRRRLCEGSSSPIRARRRKKCHKEYMAVMENIAVGCTCIF
Donor tissue: