ORFeome > insig2 – XORFeome 2.0

insig2 – XORFeome 2.0

General Information

Species: Xenopus tropicalis insulin induced gene 2, mRNA (cDNA clone MGC:89499 IMAGE:6992302), complete cds
Gene Symbol: insig2
Gene ID: 496587
ORF gb_acc: MG134330
ORF ID: 12013

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC084995

Library Location

Plate ID: GDExt11020
Well Location: G08

EST Sequences

Clone: MGC:89499 IMAGE:6992302
Trimmed Sequence: ATGGGCGAGACAGACAATGCACCACGTGGCCCCCCGTCATTCCTCCCCCACAAGATGAACCTGCTGCTCCGGGGGCTCCTCCTCTTCCTCATCGGGGTGTTCCTGGCGCTGGTGCTGAACTTGCTGCAGGTGCAGAGGAACGTCACCCTGTTCCCGCCGGACGTGCTCTCCAGTCTCTTCTCCTCGGCTTGGTGGGTGCCCCTGTGCTGTGGCACGGCCGCGGCGGCCATCGGACTCCTGTACCCCTGCATCGACCGGCACCTCGGGGAGCCCCACAAGTTCAAGAGGGAGTGGTCGAGCGTCATGCGCTGTGTGGCCGTGTTTGTGGGTATAAATCACGCCAGCGCCAAAGTGGACTTTGCCAACAACACGCAGCTGTCTCTCACTCTGGCCGCTCTCTCCATCGGCCTGTGGTGGACATTTGACCGCTCTCGCAGTGGCCTGGGCCTGGGAATTGGAATCTCTTTCTTTGCTACAGTCGTCTCTCAGCTCCTGGTGTACAATGGGGTGTATGAGTACACGGCCCCCGATTTCCTGTATGTGCGCTCCTGGCTGCCCTGCATATTCTTTGCTGGGGGGATCACTATGGGCAACATTGGCCGGCAGCTGGAAATGTACGAGCGATTGGCCCTTGTAGAGAAATCTCACCGGGACTGA
Full Trace Sequence: ctagctgcaaaggctgggtgagagtgggcagtgccagcgaagctgatgggcgagacagacaatgcaccacgtggccccccgtcattcctcccccacaagatgaacctgctgctccgggggctcctcctcttcctcatcggggtgttcctggcgctggtgctgaacttgctgcaggtgcagaggaacgtcaccctgttcccgccggacgtgctctccagtctcttctcctcggcttggtgggtgcccctgtgctgtggcacggccgcggcggccatcggactcctgtacccctgcatcgaccggcacctcggggagccccacaagttcaagagggagtggtcgagcgtcatgcgctgtgtggccgtgtttgtgggtataaatcacgccagcgccaaagtggactttgccaacaacacgcagctgtctctcactctggccgctctctccatcggcctgtggtggacatttgaccgctctcgcagtggcctgggcctgggaattggaatctctttctttgctacagtcgtctctcagctcctggtgtacaatggggtgtatgagtacacggcccccgatttcctgtatgtgcgctcctggctgccctgcatattctttgctggggggatcactatgggcaacattggccggcagctggaaatgtacgagcgattggcccttgtagagaaatctcaccgggactgatggcagttggcacaagcaagacactggcacaataagggtttgtgggcaggaccttggcattactgagagctggacaggcactcactggggttcggttggactcttaattcctttggaggaaaagtgactttttcagttaaagtgcatttaattgtaattgccccaggggtgggtatgctgatgggcatgaataccccaaacctttccaggctggcgtttgtacggcccagagactgactgtgtgatcccagcgggggaggattcgggggcatattcaggggctggcattcactccatgccagggggcgggttggtgagtacagggaacagagcaatagggtatagacaccatactggcaggttgccgtcagccatacataccattcaaacattggcacgctgtgtgggcacaggtgagagcacactgaggtatagatgccaagctggcatacagtgggtactggtgcaaggtagggcacactgtgtgagtatagatgtcagtcagacagagcacactatgggtacagatgtcagtcaagcagggcacactgtgggtatagatgccagtcaggcagggaacaccatgggtatagatgcgagtcaggcagggcacgcagtgggaatagatgccagtcaggcagggcacactgtgtgagtatagatgcgagtcaggcagggcacgcagtgggtatagatgccagtcaggcagggcacaccgtggttatagatgccagtcaggcagggcacaccgtgggtatagatgccagtcaggcagggcacgctgtgtgagtacaggtgccagtcaggcaaggcacactgtgggtatagatgccagtcagacagggcacactgtgtgagtataggtgccagtcaggcaaggcacgctgtgggcatagatgccaggcaggcagggcacactgtgtgagtatagatgcgagtcaggcagggcacaccgtgggtatagatgccagtcaggcagggcacaccgtgggtatcgatgccagtcaggcagggcacaccgtggttatagatgccagtcaggcagggcacaccgtggttatagatgccagtcaggcaggacacaccgtgggtatagatgccagtcaggcagggcacgctgtgtgagtacaggtgccagtcaggcaaggcacgctgtgggtatagatgccagtcagacagggcacactgtgtgagtataggtgccagtcaggcaaggcacgctgtgggcatagatgccaggcaggcagggcacactgtgggcatagatgccaggcaggcagggcacactgtgagtatagatgccaggcagggcacactgtgtgagtatagatgccaggcaggcagggcacactgtgggtatagatgccaggcaggcagggcacactgtgggtatagatgccaggcaggcagggcacactgtgggtatagatgccaggcagggcacactgtgggtatagatgccaggcaggcagggcacactgtgggtatagatgccaggcagggcacactgtgggtatagatgccagtctgtattttatgtaaatgtaacgtttctctggctgcacaagtgaaagacaagaagggagagatccgacccccccattctgcacagagcaataaatctgctttatttggggaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MGETDNAPRGPPSFLPHKMNLLLRGLLLFLIGVFLALVLNLLQVQRNVTLFPPDVLSSLFSSAWWVPLCCGTAAAAIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINHASAKVDFANNTQLSLTLAALSIGLWWTFDRSRSGLGLGIGISFFATVVSQLLVYNGVYEYTAPDFLYVRSWLPCIFFAGGITMGNIGRQLEMYERLALVEKSHRD
Donor tissue: neurula