ORFeome > irx2 – XORFeome 2.0

irx2 – XORFeome 2.0

General Information

Species: Xenopus tropicalis iroquois homeobox 2, mRNA (cDNA clone MGC:89388 IMAGE:6989141), complete cds
Gene Symbol: irx2
Gene ID: 493475
ORF gb_acc: MG133909
ORF ID: 11502

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC081317

Library Location

Plate ID: GDExt11014
Well Location: E08

EST Sequences

Clone: MGC:89388 IMAGE:6989141
Trimmed Sequence: ATGTCCTATCCTCAGGGTTACCTCTACCAGCCTCCCGGCTCCCTAGCGCTCTACTCCTGCCCGGCGTACGGGGCTTCAGCGCTGGCCGCCCCCAGGAGCGAGGAGCTGGCCAGGTCATCGTCCGGCTCCGCCTTCAGCCCCTACCCGGGATCGGCTGCCTTCACTGCCCAAGCGGCCACGGGCTTCAGTAGCCCCCTGCAGTACTCCAGCGACCCGGCCGGATTCCCTTCTTACATGGGATCGCCTTACGATGCGCACACAACTGGCATGACTGGGGCCCTCAGCTATCACCCCTATGGAAGTGCAGCTTATCCCTACCAACTTAATGATCCTGCATACAGGAAAAACGCTACCAGGGACGCTACCGCCACCCTAAAAGCCTGGCTGCAGGAGCACAGGAAGAACCCTTACCCCACCAAGGGGGAGAAGATCATGCTGGCCATAATCACCAAGATGACCTTAACCCAGGTCTCAACGTGGTTTGCCAATGCCAGAAGGAGACTAAAGAAGGAGAATAAGATGACCTGGGCTCCCAGGAATAAAAGCGAAGACGAAGATGATGATGAAGGCGATGGGGAAAGGGTTAAAGAAGAACAATCGGAAAAGGCCCAAGACTGCAATGAGACTTCAGCAGAGGACGAAGGTATCAGTCTGCACGTTGACTCCCTGACAGATCATTCTTGTTCGGCTGATTCCGATGGAGAGAAGTTGCCTTGTAGGGCCACCGACCATCTTTGCGAATCGGGGTCCGAATCTAAAGAGAAATATGACGACGATGAAGACGAAGAGGAAGGTGATGAAGAAGACAGAGTGCTCCCAGTTAAACCTGCAACCTCATCCCCACTCACAGGTGTGGAAGCACCAATTCTAAATCACCAACAGGACGGAAGCCCAAGAAACTCAAATAAGACAAGTTTGGACAATGGAATGTCTCCAAGTTCGCAGACACCAGCCAGCAAACCAAAACTGTGGTCACTAGCTGAAATAGCCACCTCGGATCACAAGCATTCTAACCTGGGTTCTGTCTTATCTTCTGCCACTTCTTCCGCAGCTCACAATCCCAGCTACCCCTCCTCTTCACTCCTAGGGAGGCACATATATTATACATCGCCTTTTTATAGCAATTATACGAACTATGGGAATTTCAATGCTCTCCAAAGCCAAGGGATTCTGCGGTATAGTTCCGCAGCAGTGACTGCTAATGAAGGACTAAACCAGACTGTACTAAGCACCAGCTCCATGCACAAACACACCAGTGACTCTGTAAGAACAGCCAGCAACCAGCTAGATCAGCACTACAGGCCCACAAACTTCGAATCTAAAAAAGATCCCAGTGAAGTCTGCACAGTAGGAGTACAACCATACCCATAG
Full Trace Sequence: cctccctgccagaaaaaaagtccatcctggcagcaggcgctgggggagctggctggctgtgggagctccatatgcagcagccactttgttgagcaccttgatcactctgctctgcttctccttcctgtgagcctctctccagctcatgatctgcttctcccctccatcacccctctgcgcttattctctgattggatttctacctatccatgatcacacagagagcagattgatctgcggctggtgggtgccccagaggggaggggtggaggcaggacacttttatttccttgcatgagtgaggacagaagcgagaaggcacagctgagcgagaataagggcagaaaacactgtcgttattgacctgccccctccccttttcaccctgatccgtgtaactcagtcagctcggtgattctctgcttctgcacccggagctgccatgtcctatcctcagggttacctctaccagcctcccggctccctagcgctctactcctgcccggcgtacggggcttcagcgctggccgcccccaggagcgaggagctggccaggtcatcgtccggctccgccttcagcccctacccgggatcggctgccttcactgcccaagcggccacgggcttcagtagccccctgcagtactccagcgacccggccggattcccttcttacatgggatcgccttacgatgcgcacacaactggcatgactggggccctcagctatcacccctatggaagtgcagcttatccctaccaacttaatgatcctgcatacaggaaaaacgctaccagggacgctaccgccaccctaaaagcctggctgcaggagcacaggaagaacccttaccccaccaagggggagaagatcatgctggccataatcaccaagatgaccttaacccaggtctcaacgtggtttgccaatgccagaaggagactaaagaaggagaataagatgacctgggctcccaggaataaaagcgaagacgaagatgatgatgaaggcgatggggaaagggttaaagaagaacaatcggaaaaggcccaagactgcaatgagacttcagcagaggacgaaggtatcagtctgcacgttgactccctgacagatcattcttgttcggctgattccgatggagagaagttgccttgtagggccaccgaccatctttgcgaatcggggtccgaatctaaagagaaatatgacgacgatgaagacgaagaggaaggtgatgaagaagacagagtgctcccagttaaacctgcaacctcatccccactcacaggtgtggaagcaccaattctaaatcaccaacaggacggaagcccaagaaactcaaataagacaagtttggacaatggaatgtctccaagttcgcagacaccagccagcaaaccaaaactgtggtcactagctgaaatagccacctcggatcacaagcattctaacctgggttctgtcttatcttctgccacttcttccgcagctcacaatcccagctacccctcctcttcactcctagggaggcacatatattatacatcgcctttttatagcaattatacgaactatgggaatttcaatgctctccaaagccaagggattctgcggtatagttccgcagcagtgactgctaatgaaggactaaaccagactgtactaagcaccagctccatgcacaaacacaccagtgactctgtaagaacagccagcaaccagctagatcagcactacaggcccacaaacttcgaatctaaaaaagatcccagtgaagtctgcacagtaggagtacaaccatacccatagatgtgcagtcagacagcaatgcaagtagatgtcacaattggtttgaaaaaagtcagcaagccatcacctcttcccctgctaataagtattacaaatatctaaatccggatcacactctgtgccactgtagaaacgaagatcaacagaacactattaaagctccatatatttttaatacaaagagatctcccttggacatatgtgaaattcttggtatagtatagttaccccgatcttgtgactctctgcaaacaatgatctgttttctcaggatatcttgacttgatcacttcattgccacgacatgtattcaataggtgtgatagaataaattgtgaagaatggagagaagaaaatatttgtgaaagatgtatacaatagagaccataattcctaaatgaggaactggagtacttaaaatatcgggttaaaaggaaacaaaaaagtgtaaagaaaaaacacagatttgatatttatttttgtaatgatgatattaaagcttatagtaatttatgcaagttgtattgcaaagaaattcccaaacttgtttttgtaaataaatgttgcctggtttttatttgaaaacaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSYPQGYLYQPPGSLALYSCPAYGASALAAPRSEELARSSSGSAFSPYPGSAAFTAQAATGFSSPLQYSSDPAGFPSYMGSPYDAHTTGMTGALSYHPYGSAAYPYQLNDPAYRKNATRDATATLKAWLQEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWAPRNKSEDEDDDEGDGERVKEEQSEKAQDCNETSAEDEGISLHVDSLTDHSCSADSDGEKLPCRATDHLCESGSESKEKYDDDEDEEEGDEEDRVLPVKPATSSPLTGVEAPILNHQQDGSPRNSNKTSLDNGMSPSSQTPASKPKLWSLAEIATSDHKHSNLGSVLSSATSSAAHNPSYPSSSLLGRHIYYTSPFYSNYTNYGNFNALQSQGILRYSSAAVTANEGLNQTVLSTSSMHKHTSDSVRTASNQLDQHYRPTNFESKKDPSEVCTVGVQPYP
Donor tissue: gastrula