ORFeome > itm2b – XORFeome 2.0

itm2b – XORFeome 2.0

General Information

Species: Xenopus tropicalis integral membrane protein 2B, mRNA (cDNA clone MGC:76131 IMAGE:5309256), complete cds
Gene Symbol: itm2b
Gene ID: 394850
ORF gb_acc: MG132703
ORF ID: 9994

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC063911

Library Location

Plate ID: GDExt11001
Well Location: D09

EST Sequences

Clone: MGC:76131 IMAGE:5309256
Trimmed Sequence: ATGGTCAAATTATCCTTCAACTCGACGCTGAGCCAAAAGGACGGAAAGAAGGAAGATGAGAATAATGAAGTGCTTATCATTCCCGAGGCCAAGGAGCCTGAAGACATTGTGCCACTTGGACAGAGAAGGGCGTGGTGTTGGTGTATGTGCTTTGGCCTAGCGTTCATGCTCGCTGGGATTGTTCTGGGTGGTGCATATCTCTACAAATACTTTGCTATGCAGCGTGGTGTTTACTTCTGTGGAATAAGGTACCTTGAGGATGATGCAGCACTTACTGAACCTTATGCAGAGACCCCAGTGCGCTACCATTCATTTAAGGAGAGCATTCAAATCCTGGAGGAGGAAGATGTTGAACTGATCAATGTGCCTGTTCCAGAATTTGCTGACAATGACCCCGTGGACATTGTTCACGACTTTCACAGGAAACTGACTGCATACTTGGATCTGAATCTGAACAAGTGTTATGTCATTCCTCTGAACACATCCATCGTCATGCCACCAAAGAATTTCCTGGAACTGCTTCTTAACATCAAGGCTGGAACGTACTTGCCCCAGTCCTACTTAGTTCATGAACAAATGATTGTTACTGACCGTATTGAAAATGTAGACCAACTTGGATTCTTCATCTACCGCCTGTGTCGTGACAAGGAGACTTATAAACTCCAGCGCAAGGAGACTATTCGAGGATTCCAGAAACGGGAAGCTGAAAACTGCCATACAATTCGACACTTTGCTAATAGGTTTGCTGTGGAGACACAGATTTGCGAGCATTAA
Full Trace Sequence: attcgcagtcagaccatacacaaagcgaaagagattcgcccagtgtttagctcccccacattctgcacctcggcgcggccccaggcagacatggtcaaattatccttcaactcgacgctgagccaaaaggacggaaagaaggaagatgagaataatgaagtgcttatcattcccgaggccaaggagcctgaagacattgtgccacttggacagagaagggcgtggtgttggtgtatgtgctttggcctagcgttcatgctcgctgggattgttctgggtggtgcatatctctacaaatactttgctatgcagcgtggtgtttacttctgtggaataaggtaccttgaggatgatgcagcacttactgaaccttatgcagagaccccagtgcgctaccattcatttaaggagagcattcaaatcctggaggaggaagatgttgaactgatcaatgtgcctgttccagaatttgctgacaatgaccccgtggacattgttcacgactttcacaggaaactgactgcatacttggatctgaatctgaacaagtgttatgtcattcctctgaacacatccatcgtcatgccaccaaagaatttcctggaactgcttcttaacatcaaggctggaacgtacttgccccagtcctacttagttcatgaacaaatgattgttactgaccgtattgaaaatgtagaccaacttggattcttcatctaccgcctgtgtcgtgacaaggagacttataaactccagcgcaaggagactattcgaggattccagaaacgggaagctgaaaactgccatacaattcgacactttgctaataggtttgctgtggagacacagatttgcgagcattaaatcaataagtgaacctgtcttcaaccattttaacagtatagccctacctttttgttgtgtgcagtaattttttctaaggaagggttttattattagtgaacaggcatttgcaaaccatttttgaacattcatctcgtataatatccagaataggtttttaagtatttgtttttcctcttccttatttcagctttcaagtgtggtgttttattatattttttttcagtgtaacaaattagtaatgtaaaaataagggtttaagcttgctaaaaaagaaagtgtgacctaaaactgaaaaaaagtttttaatggtcacgatttacaccttttattacactttgcattccatgacactgacatcacttccaccagttatagcaaaacgtgcgcatctattaacgtcttaaagtctgtttaatattgcatgttcagtcacttgaaaagacctaaatttaacaactttgtattttaaactagaaacatatataatgatgtttcagaagagctcagggctacaacaaaaaaggcagtgattagtgtaacataaaagtagtgtttcaaattacatgtacccaattccctattcactgattctagatttatttaaggtttgtttggaactggaagtggctgtacgacgttaggtgtcattttgtggtgaagaaaagaaattctcagtacagtagtgctgattatagtatgtctgctctggtaagttagcagaatcattgaattcttttcatttccagttatttataaagtctagtaactctggtttacttaatataattttaatcaggcccgacctgctgagtttacactggatcatattaatttaaaccgtttaatttttttatttttcacatggtctctacgatagattgtacacagtgtaagatgctgtgatggagctcatgcaccattaagctattcagaagtgtgcaaggccaagcaatggatgaataatttactccttagtttgcttccttacaaaaatgaatactcatttgaaggtaaattatccaagtctctttagttgcttggaaatgacagggcactgggccatggtttagtttattgacaaatttgtagttaaaataaggggtggttttgtatgtgcacatttgctttaaggaataatgctaactctttgtttgcatgtcacccagcaaatttgtagattttaacaagtgacctgcctttaagctctattaaactgaaaatatctatatgacctagcaaacagtgccgttttttattttcatgtttaacctttttaattcttgtaaaccttaatggttgtttttcccttcttctggcaatatttaaacgagcaaagaataaatgaattagaagtaatgtggtactaatttgtatataatcatacttgtaaaggaataaatcttacacaactcgtttaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MVKLSFNSTLSQKDGKKEDENNEVLIIPEAKEPEDIVPLGQRRAWCWCMCFGLAFMLAGIVLGGAYLYKYFAMQRGVYFCGIRYLEDDAALTEPYAETPVRYHSFKESIQILEEEDVELINVPVPEFADNDPVDIVHDFHRKLTAYLDLNLNKCYVIPLNTSIVMPPKNFLELLLNIKAGTYLPQSYLVHEQMIVTDRIENVDQLGFFIYRLCRDKETYKLQRKETIRGFQKREAENCHTIRHFANRFAVETQICEH
Donor tissue: gastrula