ORFeome > jagn1 – XORFeome 2.0

jagn1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis jagunal homolog 1, mRNA (cDNA clone MGC:69560 IMAGE:5379015), complete cds
Gene Symbol: jagn1
Gene ID: 431675
ORF gb_acc: MG133424
ORF ID: 10935

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC067954

Library Location

Plate ID: GDExt11009
Well Location: D06

EST Sequences

Clone: MGC:69560 IMAGE:5379015
Trimmed Sequence: ATGGCCTCCCGTGCTGGCCCTCGGGCAACTGGTACAGATGGAAGTGACTTTCAGCATCGAGAGAGAGTAGCCAGCCACTATCAGATGAGTGCTTCTTTAAAGAATGAAATCAAGAAGCTGATCTACGCCCACTTGGTTATCTGGCTGCTGATCGCTGCTCAGATGTGTGTGTCTCATCTAAAATTGGTCTCCAAGGATTTGGTAGCCATGCCATACCAATGGGAGTACCCATACCTCCTGAGCCTTGTCCCGTCCCTCTTCGGTCTCGTCTCTTTCCCCCGGAACAACATCAGCTATCTGGTGATCTCCATGATTAGCACGGGACTCTTCTCCATTGCTCCCCTCATCTACGGCACCCTAGAGATGTTCCCTATGGCACAGCAGCTGTACCGCCATGGCAAGGCCTACCGCTTCATCTTCGGCTTCTCCGCCATCTCTGTTATGTACTTGCTCATGGTGGTGGCCGTACAGGTTCATGGATGGCAGATCTACTACAGCAAGAAGCTGTTGGACGCTTGGTTCACAAACACTCAGGAGAAGAAGAAGAAGTAA
Full Trace Sequence: gccgaagcgccgggttcattgagcgtgatcaataatggcctcccgtgctggccctcgggcaactggtacagatggaagtgactttcagcatcgagagagagtagccagccactatcagatgagtgcttctttaaagaatgaaatcaagaagctgatctacgcccacttggttatctggctgctgatcgctgctcagatgtgtgtgtctcatctaaaattggtctccaaggatttggtagccatgccataccaatgggagtacccatacctcctgagccttgtcccgtccctcttcggtctcgtctctttcccccggaacaacatcagctatctggtgatctccatgattagcacgggactcttctccattgctcccctcatctacggcaccctagagatgttccctatggcacagcagctgtaccgccatggcaaggcctaccgcttcatcttcggcttctccgccatctctgttatgtacttgctcatggtggtggccgtacaggttcatggatggcagatctactacagcaagaagctgttggacgcttggttcacaaacactcaggagaagaagaagaagtaacaaaaccaagtgactttttagagccaaggtacaatgataggaaggtgcaaaggggcagaggtgcacggcacaactgtaatacagtatcgtaacgtggaacatgaattaataaacccaagagcagatatggtgaaagagtgctttccagtgccaggaattgtccaacctgatggcttccattttgtattgaactgcaaatccatcagtagttgaggggtagtgaaattgtagctcagaggctgggcaccactgcagttaattgccatgccaggctagaatgttttcaacattttatttttttccccagaggcaccttgagatgactgtaaacatgaaaaccttgatacatggagcccctcatataagctacttattgggctttgggtgttaaacagctacagttttcctggggtccctaccatttttgggggcttactgcaccactatcaccatttactttcatgctataagccatcattcccaaactgagccattgcaccccccaaacagtggatattgatattctgagacagtttgcaatggtttttcattttttgtggtatttcagatatttagcttttttattcagtaactctccggtttggattttcagcagctatctggttgccatggccttggcttacctaagcaaccaggcagtggtttaaatgagattgaaatatgtacaggagaggggcagaataaaaagataaggatcaaaaagtaacaataatattacagagcagtagtttttggctgctggggtcagtgacttccatttaaagcaggaaagatgtagaagagaaaggcaaataatacagaaactataaaaaatatgtaatggagaccaattgcaaagttgttaggaataggacagtctataatatattaaacgttaaagtaatggtgaaccacccctttaaggtgcagtatggggtgaatccccacagataattctgaactatatagtcactgctataggattttaataccttgttaggagcaaaggtgagcgtgaccaagtattggcctatcagagacgcctgagcagttaactgaagggtaggttttttgtttttttttaatcattgctttataagaaattgtgctatctgagtaattatttctataatttaatgggagccgccctatggcttggtttaactgagcagaatctattgctcataatgttgttcctatagaattctggcaagcattatggcagctcctaattctgcataaatccaaatatgcccccaatatgttctgtgctcaccaaatactgtatgtttaaggaggaatagaagcccgataaaccctgctgctagtcttttatgtggtctcttgtttttttattaaagggtaaatgtcccctctgtaattgacttgtggaaccatctaaatggaaccagtttggcagccttacaaagtgtcattgtgcatgagccttacacaccataggcctttgctactggattgtacccaggcctgtttcctttctgagcatttgtacttggtatttgcatgcagcgacacgtgtacaaactgtagatcaatgtgtaaatgtgccctttaatgtgctccatagtgtaaacctctcgccagttcagccaagaataaaaccaactaatatgaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MASRAGPRATGTDGSDFQHRERVASHYQMSASLKNEIKKLIYAHLVIWLLIAAQMCVSHLKLVSKDLVAMPYQWEYPYLLSLVPSLFGLVSFPRNNISYLVISMISTGLFSIAPLIYGTLEMFPMAQQLYRHGKAYRFIFGFSAISVMYLLMVVAVQVHGWQIYYSKKLLDAWFTNTQEKKKK
Donor tissue: tailbud