ORFeome > kctd1 – XORFeome 2.0

kctd1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis potassium channel tetramerisation domain containing 1, mRNA (cDNA clone MGC:76138 IMAGE:5309440), complete cds
Gene Symbol: kctd1
Gene ID: 394848
ORF gb_acc: MG132716
ORF ID: 10010

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC063913

Library Location

Plate ID: GDExt11001
Well Location: B02

EST Sequences

Clone: MGC:76138 IMAGE:5309440
Trimmed Sequence: ATGTCCCGTCTGTCTTTAACCCGCTCACCGGTTTCTCCCCTGGCTGCCCAAGGAATACCTCTTCCAGCACAGCTTACCAAATCCAATGCTCCGGTACATATTGATGTAGGAGGGCACATGTATACCAGCAGTCTGGCCACCTTGACAAAGTATCCAGATTCTAGAATAAGTCGGCTGTTTAATGGAACAGAACCTATTGTACTGGACAGTTTAAAACAACATTATTTCATTGACCGAGATGGGGAAATTTTCCGATACATTTTGAGCTTTCTGAGGACCTCTAAGCTGCTTCTACCAGAAGACTTTAAGGAGTTTAATCTGTTGTATGAAGAAGCAAAATATTATCAGCTGCATCCCATGGTCAAAGAACTTGAACGATGGAAACAAGATAAAGAGCACAGAAAGCATTTCCAGCCATGTGACTGTCTGGTTGTTCGAGTGACCCCTGACTTGGGGGAGAGGATTGCTCTAAGCGGAGAAAAGGCTTTAATAGAAGAGATCTTTCCTGAAACTGGAGATGTTATGTGCAACTCTGTGAATGCTGGCTGGAACCAAGATCCAACCCATGTCATTAGGTTTCCACTTAACGGTTACTGCAGATTAAACTCTGTGCAGGTACTAGAGAGAATGTTTCAGAAGGGATTTCACGTGGCTGCATCTTGCGGAGGTGGTGTCGACTCCTCTCAGTTTAGTGAATATGTATTGTGCCGTGAGGACAGGAGAATGCAACCAAACACAATGAGGATAAAACAAGAGCCACTTGACTGA
Full Trace Sequence: cgggttcctggcgttctgctctcacacaccagcctgctcctttttctctcacacactcattggggatttttttttctttttcttttcttggggtgttttttttgtgtgtgtgttggagacaagctgaaggtgggggaacacacagagaagggggcaccatacccacagcaagaggagaagctgctgagaagcgagtgaagctgaagggggagagactttgtccagctatcaaggagggaagcaaaatgtcccgtctgtctttaacccgctcaccggtttctcccctggctgcccaaggaatacctcttccagcacagcttaccaaatccaatgctccggtacatattgatgtaggagggcacatgtataccagcagtctggccaccttgacaaagtatccagattctagaataagtcggctgtttaatggaacagaacctattgtactggacagtttaaaacaacattatttcattgaccgagatggggaaattttccgatacattttgagctttctgaggacctctaagctgcttctaccagaagactttaaggagtttaatctgttgtatgaagaagcaaaatattatcagctgcatcccatggtcaaagaacttgaacgatggaaacaagataaagagcacagaaagcatttccagccatgtgactgtctggttgttcgagtgacccctgacttgggggagaggattgctctaagcggagaaaaggctttaatagaagagatctttcctgaaactggagatgttatgtgcaactctgtgaatgctggctggaaccaagatccaacccatgtcattaggtttccacttaacggttactgcagattaaactctgtgcaggtactagagagaatgtttcagaagggatttcacgtggctgcatcttgcggaggtggtgtcgactcctctcagtttagtgaatatgtattgtgccgtgaggacaggagaatgcaaccaaacacaatgaggataaaacaagagccacttgactgatgttaggcatcactttatacccctagaagtgcgcattagtccttgggatgaaaccttcaggacctgcaaaccagtattaatgaacttcatgtgactacttgttgccagtttgtaatattataagacagactcattgacgggctcacgcctcacactgcaacttttgagagtacttaaccagattggttgactatggatatatatatattcatctcaacagctgtgctgtaaagagaaaagaccaatcgtggattattatggactattaaaacatcacagtattatcagtgatgacatttttttccccatttttttatttgaagacccactcccagtatgctgcattgaacagttttcttatctctgtctgtacgtgatgcttcagatagactttttccagttacatgttaaataaaggattaaagacatggacaaattcctatgacatacccagctacagatcacatggtcacaactttaagagttaagatgttaactggaaacaacaaatatattttgcatatgtgtgctacatggagggcatttggatcctatcataattagcaacttttccttgttccaaattcttcttattattatgcatggttaggagggctgttgaaagaggaatatatagtgcagaatcaaggtttccaaactactgtgctatctaatatatttaaaacagaagacccaatggtgtttcagttgttaaatcaacttcaagctgctaaattattttggcaaatcatgtaaaacatttacgcccctctatattggaagaaaggcagacatgagcatgagggatgttggttatagtcacaattatgtaatatagtttgagaatgactatgttgccaacagtccatgcagacctaagagatattatgttattgacattttcaggtggaactactggtgaagcagctttttaaacatagggtgaataaagaaatgaataaacgttaatttagagcctatcagattaaatttgttcacttgtttatgtgataaacgctctagtgttacactcggggacagccatcatctgggattccagcagttgctaaaaacagctttaagcatcctcagcaggtctgctgcaagctggaattccgcaacagctaaagtttgcctgttcttagtaacacagctttctcagctctagatttatttcctttatatcaggatttacagatgaagagacattttgcaaagttctgtttttaaacatgttctgaagtaacaattatttatccttgtcctctccccacccatattaatttatagcttttaatgatgacttgaacagacgtatatggtaagctaatgtatataacaattgtatgaccaatcttagatgccaagaatgtttttaatgcaatagttctgacgttgcttgcagtagcagaatccttcagccctggaagttgtattagtgtacaaaagacaatagatcaccacatgattagcatccaatattacattttaaaaatattttgtgcgacaattttatacccacgatgaacaatttgctgaatattggtgctgtcatattggagaacatagcactgcattgaatttgtacattaaatatatgtagacttgtataatatacattattgtaaaaataaaaaaaaaaaaaaaaaaaaa
Translation: MSRLSLTRSPVSPLAAQGIPLPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPDSRISRLFNGTEPIVLDSLKQHYFIDRDGEIFRYILSFLRTSKLLLPEDFKEFNLLYEEAKYYQLHPMVKELERWKQDKEHRKHFQPCDCLVVRVTPDLGERIALSGEKALIEEIFPETGDVMCNSVNAGWNQDPTHVIRFPLNGYCRLNSVQVLERMFQKGFHVAASCGGGVDSSQFSEYVLCREDRRMQPNTMRIKQEPLD
Donor tissue: gastrula