ORFeome > ldhb – XORFeome 2.0

ldhb – XORFeome 2.0

General Information

Species: Xenopus tropicalis lactate dehydrogenase B, mRNA (cDNA clone MGC:75741 IMAGE:5381382), complete cds
Gene Symbol: ldhb
Gene ID: 394477
ORF gb_acc: MG132934
ORF ID: 10301

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC059747

Library Location

Plate ID: GDExt11003
Well Location: H09

EST Sequences

Clone: MGC:75741 IMAGE:5381382
Trimmed Sequence: ATGGCTTCTGTTCAAGAGAAACTGATCACTCCTGTGTGCCAGGATAAGGCTGCTAAACCCAAGAACAAAATAACCGTTGTTGGGGTCGGACAAGTTGGCATGGCCTGCGCTGTCAGTGTCCTCCAGAAGGATTTGTGTGATGAGCTTGCTCTAGTTGATATCTTGGAAGACAAACTAAAGGGTGAGATGATGGATCTGCAACACGGTTCCCTGTTCCTCAAGACTTCTGTCATTGTGGCTGACAAAGACTATTCCGTAACTGCTAACTCTAGAATTGTTGTGGTAACCGGTGGAGTCCGCCAGCAGGAAGGAGAGAGTCGTCTCAACTTGGTCCAGAGGAACGTCAATGTCTTTAAGTTCATTATCCCTCAGGTTGTCAAATACAGCCCTGACTGCATCATCATTGTGGTCTCCAATCCAGTGGACATCTTGACCTATGTCACCTGGAAACTGAGTGGCCTGCCCAAGCACCGTATCATTGGCAGTGGAACCAATCTGGATTCTGCACGGTTTCGCTATCTGATCGGTGAGAGGCTTGGGATTCATCCATCCAGTTGTCATGGCTTCATTCTAGGAGAACATGGAGATTCCAGTGTGGCTGTCTGGAGTGGTGTTAATGTCGCTGGAGTTGGTCTCCAGTCCCTTAATCCTGAAGTCGGCAGTGACCAAGACTCCAGCAAATGGAAAGAGGTTCACAAGCAAGTAGTTGACAGTGCCTATGAAGTGATCAAGCTTAAAGGCTACACCAACTGGGCCATTGGCTTCAGTGTGGCTGACATAATAGAGTCCATTACTAAAAACATGAGCCGAGTCCATCCAGTTTCAACAATGGTAAAGGGCATGTATGGCATTGAGAATGAAGTGTTCCTGAGCCTCCCATGTGTCCTAAATGGAAATGGATTGACCAGTGTCATCAACCAGAAGCTGAAGGATGAAGAGGTTGGTCAGCTGCAGAAGAGCGCAGAGACCTTATGGGGCATCCAGAAAGACCTGAAAGACCTATAA
Full Trace Sequence: cgagctgcaagatagagggatccctaacagcctgcagagtaatagaacaccatggcttctgttcaagagaaactgatcactcctgtgtgccaggataaggctgctaaacccaagaacaaaataaccgttgttggggtcggacaagttggcatggcctgcgctgtcagtgtcctccagaaggatttgtgtgatgagcttgctctagttgatatcttggaagacaaactaaagggtgagatgatggatctgcaacacggttccctgttcctcaagacttctgtcattgtggctgacaaagactattccgtaactgctaactctagaattgttgtggtaaccggtggagtccgccagcaggaaggagagagtcgtctcaacttggtccagaggaacgtcaatgtctttaagttcattatccctcaggttgtcaaatacagccctgactgcatcatcattgtggtctccaatccagtggacatcttgacctatgtcacctggaaactgagtggcctgcccaagcaccgtatcattggcagtggaaccaatctggattctgcacggtttcgctatctgatcggtgagaggcttgggattcatccatccagttgtcatggcttcattctaggagaacatggagattccagtgtggctgtctggagtggtgttaatgtcgctggagttggtctccagtcccttaatcctgaagtcggcagtgaccaagactccagcaaatggaaagaggttcacaagcaagtagttgacagtgcctatgaagtgatcaagcttaaaggctacaccaactgggccattggcttcagtgtggctgacataatagagtccattactaaaaacatgagccgagtccatccagtttcaacaatggtaaagggcatgtatggcattgagaatgaagtgttcctgagcctcccatgtgtcctaaatggaaatggattgaccagtgtcatcaaccagaagctgaaggatgaagaggttggtcagctgcagaagagcgcagagaccttatggggcatccagaaagacctgaaagacctataatctgcttccatggcttggcaatatgattctgtagttctgtattgtatactagtttctagagtgatagttgtctaaataaatcctttaccaatggaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MASVQEKLITPVCQDKAAKPKNKITVVGVGQVGMACAVSVLQKDLCDELALVDILEDKLKGEMMDLQHGSLFLKTSVIVADKDYSVTANSRIVVVTGGVRQQEGESRLNLVQRNVNVFKFIIPQVVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRIIGSGTNLDSARFRYLIGERLGIHPSSCHGFILGEHGDSSVAVWSGVNVAGVGLQSLNPEVGSDQDSSKWKEVHKQVVDSAYEVIKLKGYTNWAIGFSVADIIESITKNMSRVHPVSTMVKGMYGIENEVFLSLPCVLNGNGLTSVINQKLKDEEVGQLQKSAETLWGIQKDLKDL
Donor tissue: tadpole