ORFeome > lgals4 – XORFeome 2.0

lgals4 – XORFeome 2.0

General Information

Species: Xenopus tropicalis lectin, galactoside-binding, soluble, 4 (galectin 4), mRNA (cDNA clone MGC:97683 IMAGE:6982546), complete cds
Gene Symbol: lgals4
Gene ID: 496937
ORF gb_acc: MG134397
ORF ID: 12089

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC088541

Library Location

Plate ID: GDExt11020
Well Location: E12

EST Sequences

Clone: MGC:97683 IMAGE:6982546
Trimmed Sequence: ATGGCTTATGTGGCAGCACCCGGTTATCAGCCTTTTTACAATCCAGCCATCCCATTTAGGACTCCTATTCATGGCGGCCTCCGTGCTGGGATGTCTGTCTACATTCAGGGGACTATCCCCAACCACATTACCAGGTTTGCTGTGAATTTCACTTGTGGCCAATTTGATGGATCAGACATTGCCTGCCACTTTAATCCTCGCTTTGATGGCAAAGACAAGGTTGTGTTTAACAGTCTTATTGGGGGCTCCTGGGGGTCCGAGGAGAAAAAGAAGGATTCCTTTCCTTTTCGCAAAGGGAAGAGCTTTGACCTCGCATTCATGATCAACCAAAGCGCCTTTGAGATCACAGTGAATGGCTCTTCCTTCTATAAGTTCAAACATCGTATGCCACTGGAGCGTGTGAACAGTTTGCAAGTCAGTGGGGATGTGACTGTTCAGTCCCTGACCATTGCTGGAGGTGGTGGTGGAATGCCAGCGGCCCCTATGCCTGCACCCAGTTTCCCACATCCGGGGGGGGTGATGCCATTACCAGTTTTCCCAGCTGGCAACCTACCTGTAATGGGAGGACCTGTGTATAACCCACCAGTACCCTATTATGGCTCTATCCAGGGAGGCATGTCACCGAGAAAGACAGTGATAATTAGAGGGTTTATTCCAGAAGGTGCAGAAAGGTTCCATATAAACTTTAAGGCAGGATCTTCCAACGATGTTGCTCTGCATTTTAACCCTCGGTTGACTGAAAATGTAGTGGTGAGAAACAGTCGACTTGGAGGATCCTGGGGACAGGAAGAAAGGAACCTCTCGTACAATCCATTCAGACCTGGACAATATTTTGATATTTCCATACGCTGTGGGATGGATCGCTTCACAGTTTTTGTGAATGGGCAGCATTTCTGTGACTTTGCACACAGATATTCCATGTTCCAGATGCTTGACAGGATAGAAGTTGAGGGAAATGTGGTTTTGTCTCTCGTGCAGATCTGA
Full Trace Sequence: ccaagatggcttatgtggcagcacccggttatcagcctttttacaatccagccatcccatttaggactcctattcatggcggcctccgtgctgggatgtctgtctacattcaggggactatccccaaccacattaccaggtttgctgtgaatttcacttgtggccaatttgatggatcagacattgcctgccactttaatcctcgctttgatggcaaagacaaggttgtgtttaacagtcttattgggggctcctgggggtccgaggagaaaaagaaggattcctttccttttcgcaaagggaagagctttgacctcgcattcatgatcaaccaaagcgcctttgagatcacagtgaatggctcttccttctataagttcaaacatcgtatgccactggagcgtgtgaacagtttgcaagtcagtggggatgtgactgttcagtccctgaccattgctggaggtggtggtggaatgccagcggcccctatgcctgcacccagtttcccacatccggggggggtgatgccattaccagttttcccagctggcaacctacctgtaatgggaggacctgtgtataacccaccagtaccctattatggctctatccagggaggcatgtcaccgagaaagacagtgataattagagggtttattccagaaggtgcagaaaggttccatataaactttaaggcaggatcttccaacgatgttgctctgcattttaaccctcggttgactgaaaatgtagtggtgagaaacagtcgacttggaggatcctggggacaggaagaaaggaacctctcgtacaatccattcagacctggacaatattttgatatttccatacgctgtgggatggatcgcttcacagtttttgtgaatgggcagcatttctgtgactttgcacacagatattccatgttccagatgcttgacaggatagaagttgagggaaatgtggttttgtctctcgtgcagatctgatttgcccccagacatgccacagaaaaaatgtcattcagtaccaaaataaattctgaagtaacaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MAYVAAPGYQPFYNPAIPFRTPIHGGLRAGMSVYIQGTIPNHITRFAVNFTCGQFDGSDIACHFNPRFDGKDKVVFNSLIGGSWGSEEKKKDSFPFRKGKSFDLAFMINQSAFEITVNGSSFYKFKHRMPLERVNSLQVSGDVTVQSLTIAGGGGGMPAAPMPAPSFPHPGGVMPLPVFPAGNLPVMGGPVYNPPVPYYGSIQGGMSPRKTVIIRGFIPEGAERFHINFKAGSSNDVALHFNPRLTENVVVRNSRLGGSWGQEERNLSYNPFRPGQYFDISIRCGMDRFTVFVNGQHFCDFAHRYSMFQMLDRIEVEGNVVLSLVQI
Donor tissue: tadpole