ORFeome > lgmn – XORFeome 2.0

lgmn – XORFeome 2.0

General Information

Species: Xenopus tropicalis legumain, mRNA (cDNA clone MGC:88980 IMAGE:7003811), complete cds
Gene Symbol: lgmn
Gene ID: 448252
ORF gb_acc: MG134033
ORF ID: 11648

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC075316

Library Location

Plate ID: GDExt11016
Well Location: B08

EST Sequences

Clone: MGC:88980 IMAGE:7003811
Trimmed Sequence: ATGCTTCTTCATCTGGCAGCACTGGTAAGCTTTGTTCTAGGAGCCACATCTCTGCCATTCAGCAACTCAGAGGATACAGGAAAGCACTGGGTGGTCCTTGTTGCAGGTTCCAATGGCTGGTACAACTACCGACACCAGGCAGATGTGTGCCATGCCTATCAAATAGTGAAGAGGAACGGTATCCCTGATGAGCAGATTGTTGTCATGATGTATGATGACATTGCCAATAACGAAGAAAATCCTACCAAAGGAATCATTATCAACAGGCCCAATGGAACTGATGTGTATGCTGGAGTTCTGAAGGACTATACTGGAGATGATGTCACCCCTAAAAATTTTCTGGCTGTCCTGAGTGGTGATGCTGAAGCTGTCAAAGGGAAAGGATCAGGAAAAGTCATCCACAGTGGCCCCAATGATCACGTGTTTGTATACTTTACAGACCACGGAGCACCAGGCCTGTTGGCCTTTCCCAATGATGATCTGCATGTCATGGAACTGAACAAGACCATTCAGCTTATGTATGAGAAAAAGACGTACAAAAAGTTGGTGTTTTACATTGAGGCCTGTGAATCTGGCTCCATGATGAACCACCTGCCCAATAATATTAATGTATATGCAACCACAGCTGCCAACTCCCACGAATCATCATACGCCTGTTACTATGATGAGAAACGTGACACTTACCTGGGAGATCTATACAGTGTCAGCTGGATGGAAGATTCTGATTTGGAGGACTTGACCAAAGAAACACTACACAAACAGTTTGTTCTGGTGAAGCAGCACACGAACACTAGCCATGTCATGCAGTATGGGAACAGGACAATATCACAGATGAAAGTGAACCAGTTTCAGGGCAATGGAAAGATCACTTCCCCACCACTGAATCTAGAGCCTGTGAAACACATGGACCTGACTCCCAGTCCTGATGTACCTCTAGCAATCCTAAAAAGAAAACTGATGGCCACAAATGACATTCTGCAGGCCAGAGATATTGTAAGAGAAATAAAGACACACCAAGAGGCAAAACTACTGATAAAAGAGTCTATGAGGAAAATTGTAAACATGGTGACTGAATCAGATGAGCTCACAGAAGAGATTCTGACTGACCAGGTTATCATCAACGACATGCATTGTTATAGGGATGCAGCTGAACACTTCAAAAGACAGTGCTTTAACTGGCACAATCCTCTGTATGAATATGCTCTGAGACACCTCTATGCTCTAGTCAATCTGTGTGAGTCTGGATATCCCATAGAAAGAATCCACAAGGCAATGGATAAAGTTTGTAACAGCTGGAACTGA
Full Trace Sequence: cttttgttatcaaggctgagggatcttggtgatacaaagccccagattggtatcaggttgctgttatagatataaaatgcttcttcatctggcagcactggtaagctttgttctaggagccacatctctgccattcagcaactcagaggatacaggaaagcactgggtggtccttgttgcaggttccaatggctggtacaactaccgacaccaggcagatgtgtgccatgcctatcaaatagtgaagaggaacggtatccctgatgagcagattgttgtcatgatgtatgatgacattgccaataacgaagaaaatcctaccaaaggaatcattatcaacaggcccaatggaactgatgtgtatgctggagttctgaaggactatactggagatgatgtcacccctaaaaattttctggctgtcctgagtggtgatgctgaagctgtcaaagggaaaggatcaggaaaagtcatccacagtggccccaatgatcacgtgtttgtatactttacagaccacggagcaccaggcctgttggcctttcccaatgatgatctgcatgtcatggaactgaacaagaccattcagcttatgtatgagaaaaagacgtacaaaaagttggtgttttacattgaggcctgtgaatctggctccatgatgaaccacctgcccaataatattaatgtatatgcaaccacagctgccaactcccacgaatcatcatacgcctgttactatgatgagaaacgtgacacttacctgggagatctatacagtgtcagctggatggaagattctgatttggaggacttgaccaaagaaacactacacaaacagtttgttctggtgaagcagcacacgaacactagccatgtcatgcagtatgggaacaggacaatatcacagatgaaagtgaaccagtttcagggcaatggaaagatcacttccccaccactgaatctagagcctgtgaaacacatggacctgactcccagtcctgatgtacctctagcaatcctaaaaagaaaactgatggccacaaatgacattctgcaggccagagatattgtaagagaaataaagacacaccaagaggcaaaactactgataaaagagtctatgaggaaaattgtaaacatggtgactgaatcagatgagctcacagaagagattctgactgaccaggttatcatcaacgacatgcattgttatagggatgcagctgaacacttcaaaagacagtgctttaactggcacaatcctctgtatgaatatgctctgagacacctctatgctctagtcaatctgtgtgagtctggatatcccatagaaagaatccacaaggcaatggataaagtttgtaacagctggaactgaataaacatacctgcaaaaactaacttataaaggaaggaaagagtgggtcagaggatgacctaaccactaaacttcatctgctgccaccaatccactctatgcaacccgataaatctgccttagccctacctttatagggtcaaatcagactcgaagattgagcaattaaagcatcaatcaaaactgtaaattacactaccactaattctactatcctaggactgagatgaatataccagaaggaataatatatagaggagaaggaagaatgttagagagcaaagaacaaaaacacaatccaaagatcaaaacctaaatgtttcaaatagttctttatcatagggaagtctgggaaaaagccattctcctgtgtcactggtaaaacatatatactgattttcataactccacatacttccctaatcatgaagcgaccgtttcatttacaggatcttacagtagtgatcactgttcttaggtgatgggcatcaagtcttagtttgtaacatgattttagctttaatcttttattttacattttagtatgttttaatcatttttgtttatagctgctttccgactgtctgttcagtaagaaactagaatgtgaaataactcctcctagtctctgctacagcaggcaactgagacagattcccttctgcaggaaactgtggccctgggtcaaacgtacttcattcagataaatgtcatggggtttgggatgagctggtggaatgggatattatgaccaaatgctgaacaaacaattgatttattttattactttgcaaagaatgcctggtgtgaacacattttaaattaaaacgcaggaaggaattaaatattttatgatgaccaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MLLHLAALVSFVLGATSLPFSNSEDTGKHWVVLVAGSNGWYNYRHQADVCHAYQIVKRNGIPDEQIVVMMYDDIANNEENPTKGIIINRPNGTDVYAGVLKDYTGDDVTPKNFLAVLSGDAEAVKGKGSGKVIHSGPNDHVFVYFTDHGAPGLLAFPNDDLHVMELNKTIQLMYEKKTYKKLVFYIEACESGSMMNHLPNNINVYATTAANSHESSYACYYDEKRDTYLGDLYSVSWMEDSDLEDLTKETLHKQFVLVKQHTNTSHVMQYGNRTISQMKVNQFQGNGKITSPPLNLEPVKHMDLTPSPDVPLAILKRKLMATNDILQARDIVREIKTHQEAKLLIKESMRKIVNMVTESDELTEEILTDQVIINDMHCYRDAAEHFKRQCFNWHNPLYEYALRHLYALVNLCESGYPIERIHKAMDKVCNSWN
Donor tissue: