ORFeome > LOC448052 – XORFeome 2.0

LOC448052 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein LOC448052, mRNA (cDNA clone MGC:69232 IMAGE:5307782), complete cds
Gene Symbol: LOC448052
Gene ID: 448052
ORF gb_acc: MG133213
ORF ID: 10678

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC074574

Library Location

Plate ID: GDExt11007
Well Location: A04

EST Sequences

Clone: MGC:69232 IMAGE:5307782
Trimmed Sequence: ATGGCTGGAGTGGCACTGAAGAGAGAAGGCCCCCAGTTTATTAGTGAAGCTGCAGTGCGAGGGAACGCTGCAGTGCTTGACTATTGCCGAACCTCTGTATCTGCCCTGTCTGGGGCCACTGCAGGGATCCTCGGTTTAACTGCTTTATATGGCTTCATCTTTTACTTCCTCGCCTCGTTCCTGCTGTCACTTCTGTTAGTATTAAAGTCTGGACGGAAGTGGAACAAATATTTTAAATCAAGAAAGCCACTGTTTACAGGAGGGCTCATCGGTGGCCTGTTCACTTATGTCCTTTTTTGGACCTTCCTTTACGGCATGGTGCATGTGTATTGA
Full Trace Sequence: gctgagtgttaataccgctgcgggctaaataatcagcgctccggtacagcgggctgtgttcgggacaatcccggataaaagcggactgttgggcggtctagctgacttcttgttgcaaccatggctggagtggcactgaagagagaaggcccccagtttattagtgaagctgcagtgcgagggaacgctgcagtgcttgactattgccgaacctctgtatctgccctgtctggggccactgcagggatcctcggtttaactgctttatatggcttcatcttttacttcctcgcctcgttcctgctgtcacttctgttagtattaaagtctggacggaagtggaacaaatattttaaatcaagaaagccactgtttacaggagggctcatcggtggcctgttcacttatgtccttttttggaccttcctttacggcatggtgcatgtgtattgaagcctgctacgtggttgtgtcacttggaattgctctttttaatggaatacaaggacctacactgaacataaggatctagtttttaaaataccgaacctgctgcttggttcctgttagtaacttatatagatcatattatatagatatgttctctaattaaatttgctgtacacatctagaatatttgcaattaatgaaagaagtgattgagcacatattaaatttttgggatatatcttccaaaccagtatagcccacgttaccatggatctactcaacctacccatgcgaatgggaataattaaaatccccggattgatgtgtgttttgggctaagcaatacaacatattggcctatgtactaaagctatgcattcatcacaggtccacattgaatttcatatattgtttttttctttcttatatttatttcatagtggctgaaacaaaaacaggaatgtatgcttttggattacattgacgttaaaggtttgatagagtttgcacctctaaaatagacatggtatacagataatggtattatacaaaatgcatgtaatctaatgaatcagccatacagcatatgtattccttgatggtataatggataaggtggcgtcacctttgcacctccagtgttgagtttaacatagcattgccattaaacctcactctttggaagcagtggcgtaattacaccacagcacaggccccttggaggggggtggcttgagtgcagcctccaacatagtgtagttcccctcaacagcaattaactttgatggcctgggctttccacatgtacctggtttaatctccttgtttttggttacatcacctgtcactggaaatacaattgcaacgacctgtcattctcatctaaagtcagggaaaaataaaggacaagtgcataggctgtgtacattgattggtcctgccacatgtcctgtaggggcataaattagaccagcccatacgtagctcattcgcatacggttacaggggcaatatacccccttttttcaacattagcttaatgtataattgtaatgtctagtgctcagcatactttttgtctattgttttacgtcttgcactaaacaggccaaaatctaaagatcaaagttatactctgcttcctctactgacaagcaaaatgaaaacaaatcactggtcgagcttagattgtgctcatatgaatcagaaagtagaatgtgcctttacttataacttttagttttccctgtttagtacaagaaataacaaatttcataactaaaacaaaaggcaaagttgtgatcattgacctaatgttgaaaaaaggggtatacttctttatttacagaaatgctgcagcactagtactagctcttgcaaatctactttggcaaaaggcaaagcaaacacctatggtgtgactttgtatttcccaagaaccttagggttttttttctgtgcttcttagaaacaacggaatctgtgaacaggtctattgaaatcttttgtaggcaagccaaatcctctcaccactagggctcactattttagcagctgccaagctcaaggtcactgctttaactaaagcaatcagttatctttcagcacatctgagtacaaatgtacagtcctagttttaagccctttgaatattttgttgtttagttagtattagagagcccttgttttgcctggaggaagaagtcacaccactgttctcttcctttgcagataaaaacccatgaattgttgaatacaaaaccttttgttagatctgatgcaaagtccatggtattaaacgtttaaacaattgtttgaaatcgtccttacaacagaaatgtgaataaatatgctttgagataaaaaaaaaaaaaaaaaaaaaa
Translation: MAGVALKREGPQFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTALYGFIFYFLASFLLSLLLVLKSGRKWNKYFKSRKPLFTGGLIGGLFTYVLFWTFLYGMVHVY
Donor tissue: gastrula