ORFeome > LOC496433 – XORFeome 2.0

LOC496433 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical LOC496433, mRNA (cDNA clone MGC:90001 IMAGE:7026388), complete cds
Gene Symbol: LOC496433
Gene ID: 496433
ORF gb_acc: MG133071
ORF ID: 10488

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC082740

Library Location

Plate ID: GDExt11005
Well Location: C10

EST Sequences

Clone: MGC:90001 IMAGE:7026388
Trimmed Sequence: ATGGCGATGCGTGTGCTGAGCGCGATGAGAGTCCTGAGTACAGTGACCCTTGTGCGGCGTCCCGCCCAGGAGTGCCGCCTGGTATGGAGGTCGTGCTTGGTCAGGAGCTTGGCCACCGGCTCCCAGTTGCTCTCCTCTGCCTTGAAATTTACAGATAAACATGAATGGATATCAGTTGAAAATGGAATTGGAACAGTAGGAATCAGCAAGTTTGCCCAGGATTCTTTAGGCGAAGTGGTGTATTGCAGTCTTCCAGAAGTTGGCAAAAAGCTGAATAAAATGGATGAGTTTGGGACTTTAGAGAGCGTTAAAGCTGTAAGTGAACTTTACTCCCCCCTAACAGGAGAAGTTACTGAGATAAATGGAGCACTAACAGACAATCCAGGCTTGGTCAATCAATCTTGTTACGAAGAAGGTTGGCTAATAAAGCTGACAGTAGACAACCCTTCAGAGCTTGATGATCTAATGAGTGAAGACGCCTACGAGAAATACGTAAAGGCACTTGAAGACTGA
Full Trace Sequence: aggaaaatggcgatgcgtgtgctgagcgcgatgagagtcctgagtacagtgacccttgtgcggcgtcccgcccaggagtgccgcctggtatggaggtcgtgcttggtcaggagcttggccaccggctcccagttgctctcctctgccttgaaatttacagataaacatgaatggatatcagttgaaaatggaattggaacagtaggaatcagcaagtttgcccaggattctttaggcgaagtggtgtattgcagtcttccagaagttggcaaaaagctgaataaaatggatgagtttgggactttagagagcgttaaagctgtaagtgaactttactcccccctaacaggagaagttactgagataaatggagcactaacagacaatccaggcttggtcaatcaatcttgttacgaagaaggttggctaataaagctgacagtagacaacccttcagagcttgatgatctaatgagtgaagacgcctacgagaaatacgtaaaggcacttgaagactgatcagataattttttggagttgtaacccagctagaaggttttccctgtgtaggttgagtagtggtgtctcagatcacactggtggggacttcttactgcaacagtaacggttttaatcaaatgcagtttgcataaggactggaataagggattctttttcaagagttgtccctaaatcttttgcacactatgtaattccgcatttttttatttttagatatgaataattatgctaaaacttagtaaaccttaattaacatgctgcaataagttcagattcttgtgtaattgctgcagagttctccagcaactgaagagtttattgaacatccggtaatgtagtgatttctttaaagacttcttccttgtgtgctggaatgaaaaccatcccttttttggtaccaacagccatgactgaagacaaagtttgttgcacgttcagaaataatgccttgtaattaaaactgatatgagacctttaaaaaaaaaaaaaaaaaaaaaaaaagaaaaaaaaaaaaaaaa
Translation: MAMRVLSAMRVLSTVTLVRRPAQECRLVWRSCLVRSLATGSQLLSSALKFTDKHEWISVENGIGTVGISKFAQDSLGEVVYCSLPEVGKKLNKMDEFGTLESVKAVSELYSPLTGEVTEINGALTDNPGLVNQSCYEEGWLIKLTVDNPSELDDLMSEDAYEKYVKALED
Donor tissue: