ORFeome > LOC496462 – XORFeome 2.0

LOC496462 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical LOC496462, mRNA (cDNA clone MGC:79643 IMAGE:6980151), complete cds
Gene Symbol: LOC496462
Gene ID: 496462
ORF gb_acc: MG134291
ORF ID: 11963

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC084177

Library Location

Plate ID: GDExt11019
Well Location: D07

EST Sequences

Clone: MGC:79643 IMAGE:6980151
Trimmed Sequence: ATGGCACGTCCTCGTTCACTGGTGTCGCCGCTGTTGAGCGGAGTGTTCTGCCAGTGTGACACTGTGGGTGGTGCGCCGCATACCCACGATACTCCGGCCTCTCCTTCCTTGGCTGCTGCTTTGGCCGCGGATCCGTGCGGGGGACTTGTGTGTGGGGGACCCGAGCACGAAACGCGGCTGCAGATCCTATTCCAGGAGTTGGACGTGAACAAGGACGGAGGCATCTGTATCAATGACCTGGCGGTGGGACTCAAGCGGCTGGGGGTGCATCGCACAGAGTTGGAGCTGAGGAAAATAGTGAAAGCTGGAGACAAGGACCAGGATGGACAACTGGACTTCGAAGAGTTTGTACACTACCTCCGTGACCACGAAAAGAAGCTCAGACTGGTTTTCAAGAGCTTGGACAAGAAAAATGATGGCCGAATTGATGCCCAGGAGATAATGCAGTCCCTGCGGGACTTGGGGGTGAACATATCTGAGCAGCAGGCAGAGAAGATCCTAAAGAGCATGGATAAAAATGGGACAATGACAATTGACTGGAATGAATGGAGAGACTATCACCTTTTGCACCCAGCAGAGAACATTCCTGAGATCATCCTTTACTGGAAACACTCAACGATATTTGATGTTGGAGAAAACCTGTTAGTCCCTGATGAGTTTACTGTAGAAGAGAAGCAGACTGGAATGTGGTGGCGACATTTAGTTGCAGGAGGAGGAGCAGGGGCTGTTTCTAGAACTTGCACAGCTCCTCTAGACAGACTCAAAGTACTAATGCAGGTCCATGCTTCCCGTAGCAACAACATGTCCATGCTGGGTGGCTTTACCCAAATGATCCGGGAAGGAGGGATTCGCTCCCTCTGGAGAGGAAACGGCATCAACGTGATCAAAATTGCACCAGAGTCCGCAATCAAATTCATGGCATATGAGCAGATGAAACGTATTATCGGCAGCGACCAGGAGACTCTTGGGATTCATGAGAGATTGGTAGCTGGGTCTCTGGCTGGTGTGATTGCCCAAAGCAGCATCTACCCTATGGAGGTACTGAAAACACGTATGGCCCTACGCAAGACAGGCCAGTATCAAGGCATGCTTGACTGCGGCAAAAAAATCCTACTGAAAGAGGGAGTGTCTGCATTTTACAAGGGATATGTCCCAAACATGCTCGGGATCATCCCCTATGCAGGCATTGACTTGGCAGTGTATGAGACCCTAAAGAATGCATGGCTACAGCGGTATGCCACAAGCAGTGCTGATCCTGGAGTGTTTGTCTTGCTAGCCTGTGGGACCATATCTAGTACATGTGGCCAACTTGCCAGCTACCCCCTAGCTCTCGTCAGAACACGCATGCAGGCAGAAGCTTCTGTTGAAGGTGCCCCCCAAATGACAATGAGCAAGCTGTTCAAGCACATTGTGAAAACCGAGGGAGCATTTGGACTTTACAGGGGACTGGCACCCAATTTCATGAAGGTGATCCCTGCTGTCAGCATCAGTTACGTGGTCTACGAAAATCTGAAGCTCACACTGGGAGTACAGTCCCGGTGA
Full Trace Sequence: gcctgactgagtgtgaaaagagagaagattcccggttccaatatcgcagctcgcttccccgactggttggccgctctagtctatggcacgtcctcgttcactggtgtcgccgctgttgagcggagtgttctgccagtgtgacactgtgggtggtgcgccgcatacccacgatactccggcctctccttccttggctgctgctttggccgcggatccgtgcgggggacttgtgtgtgggggacccgagcacgaaacgcggctgcagatcctattccaggagttggacgtgaacaaggacggaggcatctgtatcaatgacctggcggtgggactcaagcggctgggggtgcatcgcacagagttggagctgaggaaaatagtgaaagctggagacaaggaccaggatggacaactggacttcgaagagtttgtacactacctccgtgaccacgaaaagaagctcagactggttttcaagagcttggacaagaaaaatgatggccgaattgatgcccaggagataatgcagtccctgcgggacttgggggtgaacatatctgagcagcaggcagagaagatcctaaagagcatggataaaaatgggacaatgacaattgactggaatgaatggagagactatcaccttttgcacccagcagagaacattcctgagatcatcctttactggaaacactcaacgatatttgatgttggagaaaacctgttagtccctgatgagtttactgtagaagagaagcagactggaatgtggtggcgacatttagttgcaggaggaggagcaggggctgtttctagaacttgcacagctcctctagacagactcaaagtactaatgcaggtccatgcttcccgtagcaacaacatgtccatgctgggtggctttacccaaatgatccgggaaggagggattcgctccctctggagaggaaacggcatcaacgtgatcaaaattgcaccagagtccgcaatcaaattcatggcatatgagcagatgaaacgtattatcggcagcgaccaggagactcttgggattcatgagagattggtagctgggtctctggctggtgtgattgcccaaagcagcatctaccctatggaggtactgaaaacacgtatggccctacgcaagacaggccagtatcaaggcatgcttgactgcggcaaaaaaatcctactgaaagagggagtgtctgcattttacaagggatatgtcccaaacatgctcgggatcatcccctatgcaggcattgacttggcagtgtatgagaccctaaagaatgcatggctacagcggtatgccacaagcagtgctgatcctggagtgtttgtcttgctagcctgtgggaccatatctagtacatgtggccaacttgccagctaccccctagctctcgtcagaacacgcatgcaggcagaagcttctgttgaaggtgccccccaaatgacaatgagcaagctgttcaagcacattgtgaaaaccgagggagcatttggactttacaggggactggcacccaatttcatgaaggtgatccctgctgtcagcatcagttacgtggtctacgaaaatctgaagctcacactgggagtacagtcccggtgatgtgcaaacatggaaatggttaatggacattagactgctgtcttgggctgtaactccctggatgtgaaaggtcttgtcttcattctgtgaatgcgtttaacactaagtgactgagtaaagctgtgataatccccagagacacagggacacaaggctgcatcagagcactaggagctcctgactcaatgctctcattccactccctgctcagggggctgtagcttcttccaaattggagctttgtttacattttgacttttggttcatattttaagtttgtcatccttttacaaacccccattcatacatcccagcttttttttttttttttttaatatacattatatatttgtttagtctttttgaaggcatcatgtttgccctttaaatgtatgtttgcggtgagagtttgatgctgagaattcagcttattcgcctgcttctgtagaactgtgatttttggcactttgcccattgctgacccatgtgtgcccgcctatatatttgaatccacagtaccacctgactggtgttatgagctaggccatttgctgcttggaatgttgccattatgacatggtacttggacggctcttcccagcaagtatgcccaagactgacacatttctcacattcctcctttattttgatgtttttactgcctagcctgtatatttattacatatttattgaagaagaaatatctaacattgagctatttttacagaatgtttaattattagagtattgtggcttttttttctctttttttatttcactaacttgttttaggcttcaaagatttttgctgagtgtctgactgtaaagcagcgagcgctttatttctctgtacaccatgaccgttgccctaaatctaaagtccttgctgtgtggcagaagcaaactttaacctttctgttggaggtgggggggggcagatatgcagtggctgagtcactgaggtcacatttcacgtcattcagctgttctttcttcatttcacaagcagattatcgatctgttggggacctcactaggaaacattgcactttatgcagtagggatcttgttatctttgtggttagagtgaatggttttggtgctttactaatgccactgacttgggcgctgatgcatgatgcagcttatttccccttttctttttgtttggcctgtatcattcagttctgctgctccccaaacttatgagtccatgaaatagtaagcaagaatcaatgcaaaaaatgagaattagtctgaccatataaagcctgcctgttataagcggaatctatggaaaacatgccatgagagcttgttgtagaatccgtcaaataaaagttctctatattgtaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MARPRSLVSPLLSGVFCQCDTVGGAPHTHDTPASPSLAAALAADPCGGLVCGGPEHETRLQILFQELDVNKDGGICINDLAVGLKRLGVHRTELELRKIVKAGDKDQDGQLDFEEFVHYLRDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDLGVNISEQQAEKILKSMDKNGTMTIDWNEWRDYHLLHPAENIPEIILYWKHSTIFDVGENLLVPDEFTVEEKQTGMWWRHLVAGGGAGAVSRTCTAPLDRLKVLMQVHASRSNNMSMLGGFTQMIREGGIRSLWRGNGINVIKIAPESAIKFMAYEQMKRIIGSDQETLGIHERLVAGSLAGVIAQSSIYPMEVLKTRMALRKTGQYQGMLDCGKKILLKEGVSAFYKGYVPNMLGIIPYAGIDLAVYETLKNAWLQRYATSSADPGVFVLLACGTISSTCGQLASYPLALVRTRMQAEASVEGAPQMTMSKLFKHIVKTEGAFGLYRGLAPNFMKVIPAVSISYVVYENLKLTLGVQSR
Donor tissue: tailbud