ORFeome > LOC496468 – XORFeome 2.0

LOC496468 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical LOC496468, mRNA (cDNA clone MGC:79741 IMAGE:6983203), complete cds
Gene Symbol: LOC496468
Gene ID: 496468
ORF gb_acc: MG134307
ORF ID: 11982

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC084187

Library Location

Plate ID: GDExt11019
Well Location: H02

EST Sequences

Clone: MGC:79741 IMAGE:6983203
Trimmed Sequence: ATGGCTCAGACCTCCGGAGATGCCCTGCCAACCTATGACATCGATAATTCCCAGACATCAAAGCTGATAAGGAAGTCAAAGGAGTCTCCGTTTGTGCCAATAGGAATGGCCGGATTTGCTGCAGTGGTAGCCTATGGGCTATTCAAACTGAAGAGCAGAGGGAACACAAAGATGTCCGTCCATCTGATTCACATGCGTGTTGCAGCCCAGGGATTCGTTGTAGGAGCCATGACTTGCGGTGTCATTTACTCCATGTACAAGGAGTACCTCGCCAAGCCATCCGACCACTGA
Full Trace Sequence: caactcagcgcatcgagggacccccgatacagatacttcttctgtaaaccatggctcagacctccggagatgccctgccaacctatgacatcgataattcccagacatcaaagctgataaggaagtcaaaggagtctccgtttgtgccaataggaatggccggatttgctgcagtggtagcctatgggctattcaaactgaagagcagagggaacacaaagatgtccgtccatctgattcacatgcgtgttgcagcccagggattcgttgtaggagccatgacttgcggtgtcatttactccatgtacaaggagtacctcgccaagccatccgaccactgaggaagctgccagtctggactccatgatgacatatcagataaaccccatattggggctgtgcttttattctcttcacatatcgcaccttctctgggggcccgcaggggattgtgggacccccagagctcaaccataagatttctcttctttatattttatttttttaatttaatccagttctgtaggacatagagtgagaagaccaacaccacggactttctggaatttctatgtactgtttagaaaccatatttatttttttaagtgtatataaatacaattttaggatgatgttattacagtaatacggttggttgttagtagagatgcaccgaatccaggatttgttgcaggattcggactcagccgaaccgaatccttaatcatgtgactttttgtctctttaaccctttcggccaaacctttcgaaaaagggttcggccggatctgaaaatagtggaaccggtgcatccctagttgttggatcatccaatccttttcctgatataatattatttatcagttgtgttctgttggagcagaactcatccacatacaatccacccggaaatcctatgttagcccacccatgttgttgttctgtcaaataatagtacaggaatgtgggtgctgttacaaaatgtgtgatattaaaaataacatatctattctgctaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MAQTSGDALPTYDIDNSQTSKLIRKSKESPFVPIGMAGFAAVVAYGLFKLKSRGNTKMSVHLIHMRVAAQGFVVGAMTCGVIYSMYKEYLAKPSDH
Donor tissue: tadpole