ORFeome > LOC496518 – XORFeome 2.0

LOC496518 – XORFeome 2.0

General Information

Species: Xenopus tropicalis PKHD domain-containing transmembrane protein FLJ22222 homolog, mRNA (cDNA clone MGC:89558 IMAGE:6993803), complete cds
Gene Symbol: LOC496518
Gene ID: 496518
ORF gb_acc: MG134338
ORF ID: 12022

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC084502

Library Location

Plate ID: GDExt11020
Well Location: H05

EST Sequences

Clone: MGC:89558 IMAGE:6993803
Trimmed Sequence: ATGGCAACCAGGCACCGGCGGCGGGGGGGCTCGGCTCCCTCATGGGCTAAACCAGGCAAACCGGGGGAGCGGCCTGGGGGCCCTAAGAAGAGCCGAGGGCGCACCAGCTGGAAGAGCCTGCTGATATGGGGGGTATTTGGAGTGACCCTGGGCCTTATGGCTGGCTACTATCTCTGGGGAGAGCTGATCACCGACGACAGTGTGACTGAGGTGTTGGCAGCGCAGCGAGATGCCGTGGCGCAGAGGTTCTTCCATGTGCCCTGCTCGCAGGATTACGAGAGCCTCAAGCAGTTTGAAGCTTGCACGCCGAGGAAATGCGGACGAGCCGTGACCGACTCGGTTATAACGCTCCAGGAGGCTGAGAAGATGCGCAGATTAGCCGAGGCCGGCCTCTCTCTTGGGGGATCCGATGGAGGGGCTTCCATCCTAGACTTGCACTCGGGGGCCCTGTCGATGGGAAAGAAGTTTGTAAATATGTACCGGTTCTTTGGGGACAAACTTAAAGATGTGATGTCTGACGAAGATTTCAATCTTTATCGGGAGGTGCGACTGAAGATCCAGCACGAAATCGCAAGAACCTTCAATATAAGCGTTTCCTCCCTTCACCTTACCAAACCCACCTTTTTCTCACGCATGAACAGCTCGGAAGCCAAAACCGCTCATGATGAATACTGGCACCCCCATATTGATAAGGTGACCTACGGTTCCTTCGACTACACATCCTTGCTCTACCTCTCAGACTACTCCCAAGATTTCGGCGGGGGCCGCTTCGTCTTCATCGATGAAGGTGCAAACAGAACAGTGGAGCCTCGAACTGGTCGCCTTTCATTCTTCACTTCCGGATCGGAGAATCTTCACCGGGTGGAGAAAGTGAGTTGGGGAACGCGATACGCTATAACTATCTCTTTCACGTGCAATCCTGAGCACGCCATTGGGGACCCGACCTGGACATGA
Full Trace Sequence: cgactgattgcgcctgccagccgccctgatcccacggcacttccgcatccctgactccccgaacggggcgagattgttactatggcaaccaggcaccggcggcgggggggctcggctccctcatgggctaaaccaggcaaaccgggggagcggcctgggggccctaagaagagccgagggcgcaccagctggaagagcctgctgatatggggggtatttggagtgaccctgggccttatggctggctactatctctggggagagctgatcaccgacgacagtgtgactgaggtgttggcagcgcagcgagatgccgtggcgcagaggttcttccatgtgccctgctcgcaggattacgagagcctcaagcagtttgaagcttgcacgccgaggaaatgcggacgagccgtgaccgactcggttataacgctccaggaggctgagaagatgcgcagattagccgaggccggcctctctcttgggggatccgatggaggggcttccatcctagacttgcactcgggggccctgtcgatgggaaagaagtttgtaaatatgtaccggttctttggggacaaacttaaagatgtgatgtctgacgaagatttcaatctttatcgggaggtgcgactgaagatccagcacgaaatcgcaagaaccttcaatataagcgtttcctcccttcaccttaccaaacccacctttttctcacgcatgaacagctcggaagccaaaaccgctcatgatgaatactggcacccccatattgataaggtgacctacggttccttcgactacacatccttgctctacctctcagactactcccaagatttcggcgggggccgcttcgtcttcatcgatgaaggtgcaaacagaacagtggagcctcgaactggtcgcctttcattcttcacttccggatcggagaatcttcaccgggtggagaaagtgagttggggaacgcgatacgctataactatctctttcacgtgcaatcctgagcacgccattggggacccgacctggacatgacacatttcactccactcctatcttattccttaacccccctgacagtgatgttggaccgcggatcagttgggctcaacctataatcagtaaccaattactgattagacatatggtgctcaacagggtcagccaagtagactcaaccactccaagaggggggcattctccttcccccctcccttttctactttccatatctgcatcattagtttttacattttgttttcccctagatgtataatattctttcatcggctaaatcaggtttcatgagtttgtatatctgcgtggcataccttttccacgccacaataatcctgtgatcaaattgaacaaaatgggtttggttctacaaaaaaaatccagttatgtgcatcccttttattactttgcaatgagatgtttccaaaatgaaaatactgtgaaaaagaaaatccgagcatggcggccatattaaaaccctgagcattgattggggtattagaatccttggtaacttgatttaatttgtgtttgtaactcggctacacgggtgcatcccagcgttctgagggcgagtctttctgcaatgggaccaaattgggatcaaagacttttaaggagggtaatacattctgattggaataaattcttttctaccacaaaaaaaaaaaaaaaaaa
Translation: MATRHRRRGGSAPSWAKPGKPGERPGGPKKSRGRTSWKSLLIWGVFGVTLGLMAGYYLWGELITDDSVTEVLAAQRDAVAQRFFHVPCSQDYESLKQFEACTPRKCGRAVTDSVITLQEAEKMRRLAEAGLSLGGSDGGASILDLHSGALSMGKKFVNMYRFFGDKLKDVMSDEDFNLYREVRLKIQHEIARTFNISVSSLHLTKPTFFSRMNSSEAKTAHDEYWHPHIDKVTYGSFDYTSLLYLSDYSQDFGGGRFVFIDEGANRTVEPRTGRLSFFTSGSENLHRVEKVSWGTRYAITISFTCNPEHAIGDPTWT
Donor tissue: neurula