ORFeome > LOC496601 – XORFeome 2.0

LOC496601 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical LOC496601, mRNA (cDNA clone MGC:97513 IMAGE:5381489), complete cds
Gene Symbol: LOC496601
Gene ID: 496601
ORF gb_acc: MG134392
ORF ID: 12084

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC086494

Library Location

Plate ID: GDExt11020
Well Location: E08

EST Sequences

Clone: MGC:97513 IMAGE:5381489
Trimmed Sequence: ATGGCAGCCTCGGTGGCGAGGGTTCTGAAAGCTGCTGGCGGGCGACAGCTTCTGCTAATGGTGGCGAGGCGACGTCCCGTTCTGAGGCAGCCATTCTTGCTCATGCCTAGGAAATTTTGGGGCACATCAGCTCTGAGGTCAGAAGATCAAAAGCAACCCCCCTTCTCATCAACTTCTGCACATGCTGGGACCCCAGAACATGCTGAAGAACAATATCAGCAACAGCAGCCTCCCCCCAGATACACAGATCAGGCAGGAGAGGAATCAGAAGGTTATGAAAGTGAGGAGCAGTTACAGCAGCGTATCCTCTCTGCAGCTTTACAGTTTGTACCAGACTTTGGTTGGTCAGCAGATGCTATTGCTGAAGGAGCCAAGTCCCTGGACATGTCAGCAGCAGCAGCAGGAATGTTTGAGGATGGAGGCAGTGAGCTTGTCCTACACTTTGTTACTCAGTGCAATTCGCAACTGACTGAACTTTTGGAAGAGGAGCAAAAACTGGTCCAGTTAGGCACTTCTGAGAAGAAGCCAACAACTCAGTTCTTGAGGGATGCAGTTGAAGCTCGTTTAAGGATGCATATCCCGTATATAGAACAATGGCCACAGGCATTGGGAATGCTACTGCTCCCACGTAATATTCCTTCCAGCCTAAAGCTGCTCACTGCAATGGTGGATGACATTTGGCATTATGCAGGAGATCAGTCTACAGATGTTAGCTGGTACACACGTCGAGCAGTGCTGACTGGTATATATAACACAACTGAGCTAGTAATGTTGCAAGATTCTTCTCCAGACTTTGAAGACACATGGAAATTTCTTGAAAACCGCATTTCTGAGGCCATGACAATGGGAACCTCCGTGAAACAGGTGGCATCTACTGGAGAAGCTGTGATACAGGGTCTGATGGGAGCAGCTGTTACATTAAAGAATTTAACAGGATTGAACCAGCGCCGGTGA
Full Trace Sequence: ccagcttccaagatggcagcctcggtggcgagggttctgaaagctgctggcgggcgacagcttctgctaatggtggcgaggcgacgtcccgttctgaggcagccattcttgctcatgcctaggaaattttggggcacatcagctctgaggtcagaagatcaaaagcaaccccccttctcatcaacttctgcacatgctgggaccccagaacatgctgaagaacaatatcagcaacagcagcctccccccagatacacagatcaggcaggagaggaatcagaaggttatgaaagtgaggagcagttacagcagcgtatcctctctgcagctttacagtttgtaccagactttggttggtcagcagatgctattgctgaaggagccaagtccctggacatgtcagcagcagcagcaggaatgtttgaggatggaggcagtgagcttgtcctacactttgttactcagtgcaattcgcaactgactgaacttttggaagaggagcaaaaactggtccagttaggcacttctgagaagaagccaacaactcagttcttgagggatgcagttgaagctcgtttaaggatgcatatcccgtatatagaacaatggccacaggcattgggaatgctactgctcccacgtaatattccttccagcctaaagctgctcactgcaatggtggatgacatttggcattatgcaggagatcagtctacagatgttagctggtacacacgtcgagcagtgctgactggtatatataacacaactgagctagtaatgttgcaagattcttctccagactttgaagacacatggaaatttcttgaaaaccgcatttctgaggccatgacaatgggaacctccgtgaaacaggtggcatctactggagaagctgtgatacagggtctgatgggagcagctgttacattaaagaatttaacaggattgaaccagcgccggtgaatgagagcagagtgtgtaaccaaagcttgacatcttcacactccatatctccatcgctataagctggttgttaaagaataggcactttactgtgtgtaataaagttatttgtacattgaaaaaaaaaaaaaaa
Translation: MAASVARVLKAAGGRQLLLMVARRRPVLRQPFLLMPRKFWGTSALRSEDQKQPPFSSTSAHAGTPEHAEEQYQQQQPPPRYTDQAGEESEGYESEEQLQQRILSAALQFVPDFGWSADAIAEGAKSLDMSAAAAGMFEDGGSELVLHFVTQCNSQLTELLEEEQKLVQLGTSEKKPTTQFLRDAVEARLRMHIPYIEQWPQALGMLLLPRNIPSSLKLLTAMVDDIWHYAGDQSTDVSWYTRRAVLTGIYNTTELVMLQDSSPDFEDTWKFLENRISEAMTMGTSVKQVASTGEAVIQGLMGAAVTLKNLTGLNQRR
Donor tissue: tadpole