ORFeome > LOC496698 – XORFeome 2.0

LOC496698 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical LOC496698, mRNA (cDNA clone MGC:97509 IMAGE:5379647), complete cds
Gene Symbol: LOC496698
Gene ID: 496698
ORF gb_acc: MG134384
ORF ID: 12073

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC086493

Library Location

Plate ID: GDExt11020
Well Location: D09

EST Sequences

Clone: MGC:97509 IMAGE:5379647
Trimmed Sequence: ATGTCATTCCGAGGGAGAGGAGGCTTTAACAGAGGTGGAGGAGGAGGAAGAGGAGGTGGTGGTTTTGGAGGAAGAGGAGGTGGCCGTGGAGGTTATGGACAGGGTGGTGGAAGAGGTGGGTTTGGAAGAGGAGGCGGACGTGGAGGCTTCAACAGAGGAGGATATGACCAAGGTCCTCCTGAGAGTGTTGTTGAGGTTGGGGAATTTATGCATCCATGTGAAGATGATGTGGTGTGTAAATGCATTACACAGGAAAACAGAGTGCCTTATTTCAATGCTCCCATATACCTTGAGAATAAAGAACAGATTGGAAAAGTGGATGAGATATTTGGGCAGCTAAGAGACTTTTATTTTTCTATTAAACTCTCTGAAAACATGAAAGCATCTTCATTCAAGAAATTACAGAAGTTTTACATTGACCCAGCAAAGTTGCTTCCACTGCAAAGGTTTCTACCTCGGCCTCCTGGTGAGAAAGGTCCTCCCAGAGGAGGTGGACGAGGTGGAGGGAGAGGTGGAGGACGTGGCAGAGGTGGTGGCAGAGGAGGTGGAGGTGGCTTCAGAGGTGGAAGAGGTGGTGGATTTGGTGGTGGAGGTGGTTTTCGAGGAAGCCGAGGTGGTGGATTTCGTGGTGGACGTGGCTTTCGAGGAGGGCGTTAA
Full Trace Sequence: gccggagtgtactctgggtagtttcagagtgccgcatgcaggaagccaaacgcaactaaaggatgtcattccgagggagaggaggctttaacagaggtggaggaggaggaagaggaggtggtggttttggaggaagaggaggtggccgtggaggttatggacagggtggtggaagaggtgggtttggaagaggaggcggacgtggaggcttcaacagaggaggatatgaccaaggtcctcctgagagtgttgttgaggttggggaatttatgcatccatgtgaagatgatgtggtgtgtaaatgcattacacaggaaaacagagtgccttatttcaatgctcccatataccttgagaataaagaacagattggaaaagtggatgagatatttgggcagctaagagacttttatttttctattaaactctctgaaaacatgaaagcatcttcattcaagaaattacagaagttttacattgacccagcaaagttgcttccactgcaaaggtttctacctcggcctcctggtgagaaaggtcctcccagaggaggtggacgaggtggagggagaggtggaggacgtggcagaggtggtggcagaggaggtggaggtggcttcagaggtggaagaggtggtggatttggtggtggaggtggttttcgaggaagccgaggtggtggatttcgtggtggacgtggctttcgaggagggcgttaaattgctgtcagtccttacatgcgtggccacctgttgatttcctattttttggaatagagttggagttaatgaccttgttatattttatttttgaaatgggacttgctcttcagcattgccagtaaaatgatctgtaccggaaagatgactcggcagcaatgtttgagatccgcttacccaagcaatcttaatgcgaagatttgtagaccagaatatgtttttatgtctgatttttataactttaaattcccattcttataaccattggactgggtaggtattattcccaacaagtgctgtattattgtgattgtaacaccacacacaagaacgtctgggatggcatcatttagaccttgcgctgacacaaaggtatcatctctcaaggaggatatgtgcgctgataataaatctgcatagatgtgctggcatatgcccaaataaatgatgttcagcccaattaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSFRGRGGFNRGGGGGRGGGGFGGRGGGRGGYGQGGGRGGFGRGGGRGGFNRGGYDQGPPESVVEVGEFMHPCEDDVVCKCITQENRVPYFNAPIYLENKEQIGKVDEIFGQLRDFYFSIKLSENMKASSFKKLQKFYIDPAKLLPLQRFLPRPPGEKGPPRGGGRGGGRGGGRGRGGGRGGGGGFRGGRGGGFGGGGGFRGSRGGGFRGGRGFRGGR
Donor tissue: tailbud