ORFeome > LOC496805 – XORFeome 2.0

LOC496805 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical LOC496805, mRNA (cDNA clone MGC:97556 IMAGE:5384781), complete cds
Gene Symbol: LOC496805
Gene ID: 496805
ORF gb_acc: MG134431
ORF ID: 12131

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC088492

Library Location

Plate ID: GDExt11021
Well Location: F06

EST Sequences

Clone: MGC:97556 IMAGE:5384781
Trimmed Sequence: ATGCCTGGTCCCAGCACCATGGCCAACCTGGTAGAGTTCTTCTGGCGGGACGGGTTCGGCCGCATCCAAGAGATTCAGCAAAAACACGCGCGCCAATATGGCCGGATATTCAAGTCGCACTTTGGGCCTCAGTTTGTGGTGTCGATTGCTGATAAAGACATGGTCGCCCAAGTGCTCAGGGCAGAAAGAGATGCCCCCCAAAGGGCCAACATGGAGTCCTGGCACGAGTATCGAGAATTAAGGGGACGGTCCACTGGACTCATTTCAGCGGAAGGGGAGAAGTGGCTGAACATGCGAAGTGTCCTGCGGCAGAAGATTCTCCGGCCAAGGGACGTGGCCATGTATTCCGGAGGGGTAAATGAGGTTGTTGAAGATCTGGTAAAGAGGATCCGCAAGCTCCGAGTCCAAGAAAGTGATGGGCTGACTGTGACCAATGTCAATGATCTATACTTCAAGTACTCCATGGAAGCTATTGCCACAATCCTGTACGAGTGCCGCCTGGGGTGCCTGGACGACCAGATCCCTCAGCAGACCAAGGAATACATCGAAGCTCTGGAGCTCATGTTCAGCATGTTCAAGACGACCATGTACGCCGGCGCCATCCCCAAGTGGTTACGCCCCTTAATCCCCAAACCGTGGCGAGAATTCTGCAGGTCCTGGGACGGACTCTTCAAATTCAGTCAGATCCACGTGGACGACCGATTGCGGCAGATCGAGTCCCAGTTGGAGAAAGGAGAAGAGGTACAAGGAGGGGTCCTCACCCACCTTCTGCTCTCCAAAGAGTTGGATTTAGAAGAGATTTATGCCAATATGACCGAAATGCTCCTGGCTGGTGTCGACACGACTTCCTTTACTCTTTCTTGGGCAACATATCTGCTGGCAAAGAACCCCGGTATCCAGGAGGCCGTGTATCAGCAGATTGTGCAGAACTTTGGGAAAGATCAGGTTCCGACGGCAGAAGATGTTCCCAAAATGCCCCTGGTCAGGGCTGTCGTTAAGGAAACCTTGAGGCTCTTCCCCGTCCTGCCCGGGAACGGCAGAGTCACCCAGGATGACTTGGTTGTGGGTGGATATTTCATCCCCAAAGGGACCCAGTTGGCGCTGTGTCACTATTCCACGTCCTACGATGCCGAGTGCTTCCCGGCGGCGGAAGAGTTCAGACCGGAGCGCTGGATCCGCAGCGGAAACCTAGAACGCAAGGAGAACTTTGGCTCCATCCCATTCGGCTACGGGATCCGCAGCTGCATCGGCCGCAGGGTGGCGGAACTGGAGATGCATCTGCTGCTCATCCAGCTTCTTCAGAATTTCGAGATTAAACCGTCGCCCCAAACCACGACCGTTCTGCCCAAAACCCACGGGCTCCTGTGTCCCGGGGGGAAGATCAACGTTCGCTTCGTGGACCGACAGTGA
Full Trace Sequence: ccaggcatcagatggcagcactggggcaattactgaggggctctgcccggctggagggcttggccaggagtttccaccgattcccaggggcgcaggcagccggtcaggcgttggagcacgagcaagcggagggggtgttgggggccacagtcaaggggtccccaatggtgaagaaccttaaggagatgcctggtcccagcaccatggccaacctggtagagttcttctggcgggacgggttcggccgcatccaagagattcagcaaaaacacgcgcgccaatatggccggatattcaagtcgcactttgggcctcagtttgtggtgtcgattgctgataaagacatggtcgcccaagtgctcagggcagaaagagatgccccccaaagggccaacatggagtcctggcacgagtatcgagaattaaggggacggtccactggactcatttcagcggaaggggagaagtggctgaacatgcgaagtgtcctgcggcagaagattctccggccaagggacgtggccatgtattccggaggggtaaatgaggttgttgaagatctggtaaagaggatccgcaagctccgagtccaagaaagtgatgggctgactgtgaccaatgtcaatgatctatacttcaagtactccatggaagctattgccacaatcctgtacgagtgccgcctggggtgcctggacgaccagatccctcagcagaccaaggaatacatcgaagctctggagctcatgttcagcatgttcaagacgaccatgtacgccggcgccatccccaagtggttacgccccttaatccccaaaccgtggcgagaattctgcaggtcctgggacggactcttcaaattcagtcagatccacgtggacgaccgattgcggcagatcgagtcccagttggagaaaggagaagaggtacaaggaggggtcctcacccaccttctgctctccaaagagttggatttagaagagatttatgccaatatgaccgaaatgctcctggctggtgtcgacacgacttcctttactctttcttgggcaacatatctgctggcaaagaaccccggtatccaggaggccgtgtatcagcagattgtgcagaactttgggaaagatcaggttccgacggcagaagatgttcccaaaatgcccctggtcagggctgtcgttaaggaaaccttgaggctcttccccgtcctgcccgggaacggcagagtcacccaggatgacttggttgtgggtggatatttcatccccaaagggacccagttggcgctgtgtcactattccacgtcctacgatgccgagtgcttcccggcggcggaagagttcagaccggagcgctggatccgcagcggaaacctagaacgcaaggagaactttggctccatcccattcggctacgggatccgcagctgcatcggccgcagggtggcggaactggagatgcatctgctgctcatccagcttcttcagaatttcgagattaaaccgtcgccccaaaccacgaccgttctgcccaaaacccacgggctcctgtgtcccggggggaagatcaacgttcgcttcgtggaccgacagtgaaaatatcccggatcagaaaatccctattaacccccccaaaattgactgccacggagggacagttcctgtggaatagatctctgtggccccctaaggacaatgcactgtggcccccactgattgccagatagtggcataggacaagcagtgcccattccccttgtacatagctgtgtgtcttttagccaattacactgctaccctgcactttcgctgtaccgccgcagccaatcgcatccagcctgggcaatcgattccatgaacggacccccgactgccccccgctgggcacatttagtatcactgacgttattagtatttatatagtgagtcgcagcaactttaactctttctcctttttctggagattttacccttaattttagcttgaattttttttttctaaatcaacaataaaaatttattaaccgccaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MPGPSTMANLVEFFWRDGFGRIQEIQQKHARQYGRIFKSHFGPQFVVSIADKDMVAQVLRAERDAPQRANMESWHEYRELRGRSTGLISAEGEKWLNMRSVLRQKILRPRDVAMYSGGVNEVVEDLVKRIRKLRVQESDGLTVTNVNDLYFKYSMEAIATILYECRLGCLDDQIPQQTKEYIEALELMFSMFKTTMYAGAIPKWLRPLIPKPWREFCRSWDGLFKFSQIHVDDRLRQIESQLEKGEEVQGGVLTHLLLSKELDLEEIYANMTEMLLAGVDTTSFTLSWATYLLAKNPGIQEAVYQQIVQNFGKDQVPTAEDVPKMPLVRAVVKETLRLFPVLPGNGRVTQDDLVVGGYFIPKGTQLALCHYSTSYDAECFPAAEEFRPERWIRSGNLERKENFGSIPFGYGIRSCIGRRVAELEMHLLLIQLLQNFEIKPSPQTTTVLPKTHGLLCPGGKINVRFVDRQ
Donor tissue: gastrula