ORFeome > LOC496850 – XORFeome 2.0

LOC496850 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical LOC496850, mRNA (cDNA clone MGC:97751 IMAGE:6988116), complete cds
Gene Symbol: LOC496850
Gene ID: 496850
ORF gb_acc: MG134512
ORF ID: 12226

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC088564

Library Location

Plate ID: GDExt11022
Well Location: B05

EST Sequences

Clone: MGC:97751 IMAGE:6988116
Trimmed Sequence: ATGCAGGATCCAAACGCAGACACAGAGTGGAATGATATTCTGCGTAGAAAAGGTATCCTTCCTCCAAAGGAAAAGCCACAGGATGAAGAGGAGGAAGAAGCAGAAATTCTCCAGCAACAATCTGTTGTAAAAACATATGAAGACATGACACTTGAGGAATTGGAAGACAATGAGGATGAATTTAATGAAGAAGATGAGCGAGCAATAGAGTTGTACAGACAACAAAGAATGGCACAGTGGCAAGCAACCCAGATAAAGAATAAATTTGGAGAGGTACTGGAGATTTCAGGACAGGACTATGTCCAGGAAATTACAAAAGCTGGGAAAGATCTGTGGGTCATATTACATCTTTACAAACAGGGCATACCACTCTGTTCTTTAATCAACAAACACTTAACTGCACTGGCGCGAAAGTTCAAAGATGTGAAATTTGTAAAATCAATATCCACAACCTGCATTCCTAACTATCCTGACAAGAACCTTCCAACTATTTTTGTATATGTTGATGGAGAAATACGGGCTCAGTTCATAGGACCTCTTGTGTTTGGTGGAATGAATCTAACACAGGATGAGTTGGAATGGAAGCTTGCTGAATCTGGAGCCGTCAAGACAGACCTTGAGGAAAACCCAAAAAAGCAAATCCAGGACCATCTCATGACCTCAATCCGTGTCTCCATCCCTACAAAGAAAGACAGTGATTCAGAGGATGACTGA
Full Trace Sequence: cgggtacttcccccagccggctagcagcgtgtgtctgtgagaggcttaatcgcttacactgcgtgtgcccagggagcggcgagatgcaggatccaaacgcagacacagagtggaatgatattctgcgtagaaaaggtatccttcctccaaaggaaaagccacaggatgaagaggaggaagaagcagaaattctccagcaacaatctgttgtaaaaacatatgaagacatgacacttgaggaattggaagacaatgaggatgaatttaatgaagaagatgagcgagcaatagagttgtacagacaacaaagaatggcacagtggcaagcaacccagataaagaataaatttggagaggtactggagatttcaggacaggactatgtccaggaaattacaaaagctgggaaagatctgtgggtcatattacatctttacaaacagggcataccactctgttctttaatcaacaaacacttaactgcactggcgcgaaagttcaaagatgtgaaatttgtaaaatcaatatccacaacctgcattcctaactatcctgacaagaaccttccaactatttttgtatatgttgatggagaaatacgggctcagttcataggacctcttgtgtttggtggaatgaatctaacacaggatgagttggaatggaagcttgctgaatctggagccgtcaagacagaccttgaggaaaacccaaaaaagcaaatccaggaccatctcatgacctcaatccgtgtctccatccctacaaagaaagacagtgattcagaggatgactgaagagcaatcttttttttttttttggtcttttacaagttgcttgtacagttatgttctgtgcctataactcccaaatactgtgttattattcaaagctaaaactatggcagacttcagtctttaaaaggacatggttttctgcaaccacaagtcttactatttaccaccacttcacaggtagatattttgaacactagatgggcagcagttcatggacagaaaatctgcctaaaatgttttactaaaatgtgttaatttataacattcacagattttatatattagttacatagatgactgaacaaaatgttttataaatttaattatttttctgtgatgcaattatctggctgcatgctttgaaattacatctaaatagtggggtttcatttgttttactgccttgacaactactacatttgaaatatttgaagctttataagtagtttataactaattgaaaccattaaagaagaaggaaatgcacaatcactagggggtgccaaatgtcaggccgaaccttaggcctacaaatgcgcggtagagtaaaaaagatggattttttgtaaacatttggcttttaactctactgtgcatgcccacgcacacaaagaagaaagaagatcacttcatagtgcttgctagaaagtatcctaggccggtagagatttctgctaaaaggagcactggcctgggcttttaggtaggttattataatcaccgagtgagtccttccttcccctttaaagtacagcaaagtgccattatataatgctttataaacagggctcttaatatcctgcagatgtaatgtctattttaatgtttttgcctagtaaaattctagtaataaatacttcaaaaacaagaaatcctagaccgtatctaagtctcttagaatataaaaatacttgcagctcagtagttaatatctactggcgtcctccaccccaagctttaaatacggaaaggagcatatgctctgtagatttagctaggcccatttggggccctggaagaatgggcaataggcattaaggtttttcttctgcatacatttcttagagaggtaacacttggagctaaaggaaaaagcgatcagtagtttcagtatttggagacttgcatttgtgtagattatcatttttaagttgatgtgggtattaatgaccttggtggtcattaatacatgctctttaagattattatataaagttttttgatgggatttttatttggtgcttttttttttttttaagcagttttgattaaatacacttctgaatctcaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MQDPNADTEWNDILRRKGILPPKEKPQDEEEEEAEILQQQSVVKTYEDMTLEELEDNEDEFNEEDERAIELYRQQRMAQWQATQIKNKFGEVLEISGQDYVQEITKAGKDLWVILHLYKQGIPLCSLINKHLTALARKFKDVKFVKSISTTCIPNYPDKNLPTIFVYVDGEIRAQFIGPLVFGGMNLTQDELEWKLAESGAVKTDLEENPKKQIQDHLMTSIRVSIPTKKDSDSEDD
Donor tissue: gastrula