ORFeome > LOC548651 – XORFeome 2.0

LOC548651 – XORFeome 2.0

General Information

Species: Xenopus tropicalis parvalbumin, mRNA (cDNA clone MGC:79768 IMAGE:6984905), complete cds
Gene Symbol: LOC548651
Gene ID: 548651
ORF gb_acc:
ORF ID: 11277

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC080363

Library Location

Plate ID: GDExt11012
Well Location: F11

EST Sequences

Clone: MGC:79768 IMAGE:6984905
Trimmed Sequence: ATGGCCTTAGGTGCTCTCCTGAGTCAAGCTGACATCTCTGCTGCTCTGCAGGCTTGCCAAGCCCCTGACTCCTTCAACTACAAATCCTTCTTTGCCCAGTCTGGCCTGAGCAGCAAGTCCGTCGATGATGTGAGAAACGCCTTTGCCATCCTTGACCAGGACAAGAGCGGCTTCATTGAGGAAGATGAATTGAAACTGTTCCTCCAGAACTTCAGCGCAGGTGCCAGGGCTTTGACTGATGCTGAGACCAAGGCCTTCCTGAATGCTGGTGACTCTGATGGTGATGGCAAAATTGGAGTTGATGAATTCCAGGCTTTGGTAAAGGCTTAA
Full Trace Sequence: gtaaagtcccgtgaaagaggaattaaggacacaaaatggccttaggtgctctcctgagtcaagctgacatctctgctgctctgcaggcttgccaagcccctgactccttcaactacaaatccttctttgcccagtctggcctgagcagcaagtccgtcgatgatgtgagaaacgcctttgccatccttgaccaggacaagagcggcttcattgaggaagatgaattgaaactgttcctccagaacttcagcgcaggtgccagggctttgactgatgctgagaccaaggccttcctgaatgctggtgactctgatggtgatggcaaaattggagttgatgaattccaggctttggtaaaggcttaaacattctaccacgtgagtctgtgaactttactaaacattaaccatccacaattttgactttttctaattaaactgaaataaacggaaatctggttttgtggaacaccaccatctcttcgctgtgtttctatccgggggacaagttttggaaacatcacctgcttgcggaatccaaggattttattctgcaaagaagacattttcgttaccatcaaccaacaatggatcctatgaccagcaatgcgcctaagattcatctaataaagataacttcttatttttgtatattggtagagcattgatctcagctgtcatgacttttgtaaatccacaaacagaattctttctttcaatgtcttaatggattgaagcagcagaataaagaaaaacttgtgtgctatcaataaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MALGALLSQADISAALQACQAPDSFNYKSFFAQSGLSSKSVDDVRNAFAILDQDKSGFIEEDELKLFLQNFSAGARALTDAETKAFLNAGDSDGDGKIGVDEFQALVKA
Donor tissue: tadpole