ORFeome > LOC548849 – XORFeome 2.0

LOC548849 – XORFeome 2.0

General Information

Species: Xenopus tropicalis hypothetical protein LOC548849, mRNA (cDNA clone MGC:69183 IMAGE:5307157), complete cds
Gene Symbol: LOC548849
Gene ID: 548849
ORF gb_acc: MG134274
ORF ID: 11943

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC090565

Library Location

Plate ID: GDExt11018
Well Location: E11

EST Sequences

Clone: MGC:69183 IMAGE:5307157
Trimmed Sequence: ATGAACCTTGTGCGGGTCATATGTCGTCATAAGACGGCGCTTGCTCTGGCGGCGCTGTCCCTGTTCCTTGTGGTGCTGCTGTACTTGGCCAAATGCACCTCGGAGAGTCTGAGGCCGGCGAGTCCCCGGGGACTCCCATACCAACAGGGCGGCCATCCCCGGCAGCAGCACGGCAACGCACACGGCGCGGCGGAATTGGCGGAGAAAAGTGTCTCTACCTTCCTAGTCGTGCTCATTGCCAGCGGCCCGAAGTATTCGGAGAGGCGGAGTATCATCCGCAGTACCTGGCTGTCCGGCATCCCCTCACGGGCAGGAGAGGTGTGGGGGCGCTTTGTGATTGGCACGGCGGGACTGGGGGAGGAGGAATCGGCGGCTCTGGAGATGGAGCAGCGGCGACACGGGGACCTACTGCTGCTCCCAGATCTCCAGGACTCCTATGAGAACCTGACGGCCAAGCTGCTGCGGATGTACGTGTGGCTGGACCGGCACATAGACTACAAGTTCGTGCTGAAGGCTGATGATGACACATTTGCCCGACTCGATTTGTTAGTGGACGAGCTGCGGGCTAAGGAACCGCACCGGCTTTACTGGGGCTTCTTCTCCGGACGGGGCAGGGTGAAATCAGCGGGGAAGTGGAAAGAGAGTTCTTGGGTGCTGTGTGATTACTATCTGCCCTACGCGCTGGGTGGGGGCTACGTGATCTCCTGGGATCTAGTGCGCTATCTGAGCCTCAGCCAGGACTTCCTGGCACATTGGCAGAGTGAAGACGTGTCCCTGGGGGCATGGTTGGCACCTCTGGAGCTCAAGCGGCTGCACGACCCCCGATTTGATACCGAGTACAAGTCCAGGGGCTGCAATAACAAGTACTTAGTAACCCACAAGCAGAGCATCGAGGACATGTTAGAAAAGCATCAGACATTGGCTAAAGAAGGCAGGCTGTGCAAGGAAGAGATCAAACTAAGGCTTTCCTATATCTATGATTGGGATGTACCACCATCCCAGTGTTGCCAGAGGAAGGATGGCATTCCCTGA
Full Trace Sequence: gtaaacgtcactgcgggacttttaaacaggaatctgggactgcgggctctaacaacattggggctgttccaggagacgctgttgggcggaatgcggtgctagcctaatagtactgtcacagtcggccaagccatgaaccttgtgcgggtcatatgtcgtcataagacggcgcttgctctggcggcgctgtccctgttccttgtggtgctgctgtacttggccaaatgcacctcggagagtctgaggccggcgagtccccggggactcccataccaacagggcggccatccccggcagcagcacggcaacgcacacggcgcggcggaattggcggagaaaagtgtctctaccttcctagtcgtgctcattgccagcggcccgaagtattcggagaggcggagtatcatccgcagtacctggctgtccggcatcccctcacgggcaggagaggtgtgggggcgctttgtgattggcacggcgggactgggggaggaggaatcggcggctctggagatggagcagcggcgacacggggacctactgctgctcccagatctccaggactcctatgagaacctgacggccaagctgctgcggatgtacgtgtggctggaccggcacatagactacaagttcgtgctgaaggctgatgatgacacatttgcccgactcgatttgttagtggacgagctgcgggctaaggaaccgcaccggctttactggggcttcttctccggacggggcagggtgaaatcagcggggaagtggaaagagagttcttgggtgctgtgtgattactatctgccctacgcgctgggtgggggctacgtgatctcctgggatctagtgcgctatctgagcctcagccaggacttcctggcacattggcagagtgaagacgtgtccctgggggcatggttggcacctctggagctcaagcggctgcacgacccccgatttgataccgagtacaagtccaggggctgcaataacaagtacttagtaacccacaagcagagcatcgaggacatgttagaaaagcatcagacattggctaaagaaggcaggctgtgcaaggaagagatcaaactaaggctttcctatatctatgattgggatgtaccaccatcccagtgttgccagaggaaggatggcattccctgagcgctccttttggttttaggactgccaagtgatgtagtgttgatggtagggttgctgccttttcttggaaaagaataccggcattcctatatttttagctgtctttcttattaatgacacaggcatcaagcattattataaccagccagactggttaaatacagcgatgtggcaaccctgcgtggtggtgagcactacactgaaacaaaatgtaatatgagtccccctccatagggttcggggcttttaaaggtgtgtgtgtgagatccataaaaataacacaggcatactgagagcttttatccggcatatccagtcaacacccatccagatgtagcatgaaatatggcatcttttcattggggacaaggtggggttgtacttggtagtagtaacaaattttcgttttgtctcttcatatgttttcttttaaagttgtttttttaacttcctattttgtctcttgtcagcctccagctagaaatgctatcaagttgttggggtcccagatcccctacagcccttaaaaaaagaaaaacagagcctctgttttactggtcttcttttattatcttttttttagacccattacggtttatgacccattctcgcctagcaaccagatagtaattaacattccaagcaggatagccttacttttttgtggaactaacagcaaattgtctaccactgggtaccatgtttttaggtaaacaacccatttaaaggagaaggaaagaaaaataaagagttgatctcaagctgcaggcataccttcagttgtctcaatagtgcccttaagtctccccatatttcaatcgttcagaagatcagaagccgaacaggaagaaaaaacactgagctgggtaaataggattcccataatgcatcactcctgcacagacactacgaccaggactgtaggcggtgcatgcgcatttgtctctcttcagtgagcacacaagcaggactctgcacagtactgcacgttgcgctcgcgtctggggggggggattcgcgcaggtgcattcgcttaagcggtgccatgttggactaatttaaatatccaacaaggtggccgcaatgaacaatgtatattgagaagtcaaaacacgcactgctgcaaatagacaggacattaaggtacataaaggtagcgatcagctaaagggacttcaggacttttgatttatggggttgagagtttaaccctttccttctcctttaagaataatgcacattcttgcccttcattttttccatctgtagaagcagttgcacggtatgtgagtttggtgcaagccacagaataaaattatttttggacagtgtttttaagtaatacatatcctgccactaaatcaccatcttcccttcaaaaaaaaaaagtaatacatcataaacttaagagtggctgtataactgtgtccatttacacaccaaagaacttccttgtatatttatgttttgtatagggcctccgcaggtatccagtattgaaaataggtcaaagtgggagaaactcactcaaaattgctgagtttgtgatatgaaacaggcctaaatcatttggtctggtttcttaatgtgtctggggcttatatctgtacagatcctgtgtacatcttagcttaaaggagaactaatcccccttgggtacaaaatcctcactcaactgtcctccattggccccctcacagctcccaccgcgcacagtctatttcataagaagtgcccctattcgaaaaactgaaatgtaaatgcaccacagcaaggtggagattgcagacaccattttcacttcattacaatcctctgtgtctgttcgccaacatgaagcctgcaggagtatgttcagttaaagcagattccgcagtagctccagccgtgcatcctgcaggctttgtgctggcgaaggtgatttagaactaggggtaggcagaagaggcttgtgcctagggtgcagtggggggcactaggcatgtacctcatctcccctagttctttttctataagttcagctctattaccgagtgaggtagtttcaatgcaagggtgacgagtggggtgcctgctcatcagcaatcatccctactcttgtcaatcctgtcttcctcacttgccattatattgccaaaagtatttggacaaggcatctaaatttatctcatcggtttaaacactccctgctaatttccaaactgtcttttaagccacgtcacaataaaaagtgattttttgataagctgctgcacaaaagcctgccctgtacatttccaatcactggcttgtgtaaaggttgctgccattggaagcagtggaaacccttcataaatttctttttataatctagcagtctgacacagaagtctgggtttggtggatgtctgctagatgctacctgctttaatgcataattcaagggtaaggtttggtggggattaaaaaatgggttggggcacagtagtatgtacatactttaaggctgaactttccctaatctatttttattaaacttgaacctactttataacagaaggcatggtaactgtatataagtgtgtaaaaatcacttaacggcctcgaccgcaactattaaaataacttacgttatactgttagaatgtatttattgtgaacctagaggtcttcctttttgatgttaatggcagctgactaagaacactattatgtgaaaatatatatatatatataatgtgttaaagaagaataactaagaaaaatccacccactttctattcattcctatgggatttttcaatgactgaaagttcaccatttgataaatacgcttctaaaaatcaaaagtacactggaaaattgactagagaaagtgattaatttgtacctgttcagctaactgaatatataactcgggttgagtcaatcaaacaaatctaaattcaaccataatgttttttatataaaataaacttcagcacctcaatttacaggtccgttgtgttcaagcatgaaaatactgtaacttggtgtaacctgtttatgccaaactaatgtgttaccaatgcaagcagtgagatttacattgtagggcctagccccactgctgtactgaatattcatgtacaaattgtaaatacatgtcctgttattgaaaggattttaaaggtcttgataatttattcatatttatttaaacgttggtgaacttcttgtttttgttgtaagcaatttgcaacatcttgtctgtatatttaatatattaacttgtgcatggattgtttgtattgttaataaacatcctttatatgtgaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MNLVRVICRHKTALALAALSLFLVVLLYLAKCTSESLRPASPRGLPYQQGGHPRQQHGNAHGAAELAEKSVSTFLVVLIASGPKYSERRSIIRSTWLSGIPSRAGEVWGRFVIGTAGLGEEESAALEMEQRRHGDLLLLPDLQDSYENLTAKLLRMYVWLDRHIDYKFVLKADDDTFARLDLLVDELRAKEPHRLYWGFFSGRGRVKSAGKWKESSWVLCDYYLPYALGGGYVISWDLVRYLSLSQDFLAHWQSEDVSLGAWLAPLELKRLHDPRFDTEYKSRGCNNKYLVTHKQSIEDMLEKHQTLAKEGRLCKEEIKLRLSYIYDWDVPPSQCCQRKDGIP
Donor tissue: gastrula