ORFeome > lrrc28 – XORFeome 2.0

lrrc28 – XORFeome 2.0

General Information

Species: Xenopus tropicalis leucine rich repeat containing 28, mRNA (cDNA clone MGC:69360 IMAGE:5309350), complete cds
Gene Symbol: lrrc28
Gene ID: 448029
ORF gb_acc: MG133328
ORF ID: 10828

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC074548

Library Location

Plate ID: GDExt11007
Well Location: H09

EST Sequences

Clone: MGC:69360 IMAGE:5309350
Trimmed Sequence: ATGGCATTTGAACTCTGCCATACTATTTCTGTGGCCAGGCTGGAAAAACACAAGAATCTTTTCTTAAATTATCGGAATCTCAACCATTTCCCTCTGGAACTGCTAAAAGATGAGGGGCTGCAATATCTGGAGAGGCTTTACATGAAGCGAAACTCTTTAACGACCTTGCCTGAAAATCTTGCCCAGAAGCTTCCAAACCTTGTTGAACTGTATCTTCACTCAAATAACATTGTATTTGTCCCAGAAGCCATTGGCTCCCTGGTAAAGCTGCAGTCTTTAGACCTAAGTAACAATGCTCTGGAAATCCTGTGCCCGGACATTGGGAGACTTAAATCACTGCGACATTTACGCCTGACCAACAACCGGCTGAAATTCCTACCGCCAGAAATTGGAAAGCTAAAGGAACTGCAAACCTTGGATTTATCAACAAACCACTTGGTGAGTTTGCCAGAGAAGTTATACCAGTGTCAGTCTCTGCAGTACCTGACGGTAGATCGAAACCTGCTATGCAGTATTCCACGGCAGCTCTGTCAGCTAGCTAGCCTCAATGAGCTCTCCATGGCAGGAAACCGCCTAGCATCTCTACCATTAGATCTGGGAAGATCTCGGGAGCTGCAGTATGTGTATGTGGACAATAATGTTCAGCTAAAAGGCCTTCCCTCCTACCTGTACAATAAAGTGATTGGCTGCAGCGGCTGTGGATCACCAGTGCCTCTTACAGAGAACAAGCTGCTATCTTTTACCTCTGGGCAGCTTAGCATCCATGTCCCTGCTGAGGTAAAGTCTATTGGTTCTGCAACGGATTTTGTGCTTCCCCTCCAGGAGCTTGCACTGCGTTCCCTCCATGCTATCTTCTGCTCATTTCTACAAGATTTAAGTTGCACAACTCCTATCTCGCTACCCAAAAGTCTACTGGAACTACTGCAGTGCCCTCTTGGACACTGCCATCGATGCAGTCAATCCATGTTTACCATTGTCTATCCAAAGCTCTTTCCGCTGAGAGAGACGCCTATGGCTGGACTTCACCAGGGGAGGACTGCTGTTAGCTTTGTGGCTTATTGCTGCTCAACCCAGTGTCTGCAGACGTTTGACTTGCTAAGTTGA
Full Trace Sequence: ggcggtagctggctgccagcagagatgatatgaaatgttcctgattttcatggttagttggatggcccctttcgaaacatggcatttgaactctgccatactatttctgtggccaggctggaaaaacacaagaatcttttcttaaattatcggaatctcaaccatttccctctggaactgctaaaagatgaggggctgcaatatctggagaggctttacatgaagcgaaactctttaacgaccttgcctgaaaatcttgcccagaagcttccaaaccttgttgaactgtatcttcactcaaataacattgtatttgtcccagaagccattggctccctggtaaagctgcagtctttagacctaagtaacaatgctctggaaatcctgtgcccggacattgggagacttaaatcactgcgacatttacgcctgaccaacaaccggctgaaattcctaccgccagaaattggaaagctaaaggaactgcaaaccttggatttatcaacaaaccacttggtgagtttgccagagaagttataccagtgtcagtctctgcagtacctgacggtagatcgaaacctgctatgcagtattccacggcagctctgtcagctagctagcctcaatgagctctccatggcaggaaaccgcctagcatctctaccattagatctgggaagatctcgggagctgcagtatgtgtatgtggacaataatgttcagctaaaaggccttccctcctacctgtacaataaagtgattggctgcagcggctgtggatcaccagtgcctcttacagagaacaagctgctatcttttacctctgggcagcttagcatccatgtccctgctgaggtaaagtctattggttctgcaacggattttgtgcttcccctccaggagcttgcactgcgttccctccatgctatcttctgctcatttctacaagatttaagttgcacaactcctatctcgctacccaaaagtctactggaactactgcagtgccctcttggacactgccatcgatgcagtcaatccatgtttaccattgtctatccaaagctctttccgctgagagagacgcctatggctggacttcaccaggggaggactgctgttagctttgtggcttattgctgctcaacccagtgtctgcagacgtttgacttgctaagttgatgtgtattttggttgctaccattggttcatcttccagtttctaacgggctcctctttcccatgccttgaagtggtctgctatctagaagatccacctctgatacttcctgactttgtggaattcgaggacttctgttgtattatgggagacttttattatttccgacatgggcatctctgagttacatttccctttccttcccagtgggttatccaataaagtctatttctccctcaaacaaaaaaaaaaaaaaaaaaaaaa
Translation: MAFELCHTISVARLEKHKNLFLNYRNLNHFPLELLKDEGLQYLERLYMKRNSLTTLPENLAQKLPNLVELYLHSNNIVFVPEAIGSLVKLQSLDLSNNALEILCPDIGRLKSLRHLRLTNNRLKFLPPEIGKLKELQTLDLSTNHLVSLPEKLYQCQSLQYLTVDRNLLCSIPRQLCQLASLNELSMAGNRLASLPLDLGRSRELQYVYVDNNVQLKGLPSYLYNKVIGCSGCGSPVPLTENKLLSFTSGQLSIHVPAEVKSIGSATDFVLPLQELALRSLHAIFCSFLQDLSCTTPISLPKSLLELLQCPLGHCHRCSQSMFTIVYPKLFPLRETPMAGLHQGRTAVSFVAYCCSTQCLQTFDLLS
Donor tissue: gastrula