ORFeome > mal – XORFeome 2.0

mal – XORFeome 2.0

General Information

Species: Xenopus tropicalis mal, T-cell differentiation protein, mRNA (cDNA clone MGC:89872 IMAGE:7029205), complete cds
Gene Symbol: mal
Gene ID: 448776
ORF gb_acc: MG133151
ORF ID: 10594

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC077032

Library Location

Plate ID: GDExt11006
Well Location: E05

EST Sequences

Clone: MGC:89872 IMAGE:7029205
Trimmed Sequence: ATGGCAGCCACAACTCCTAATGCCCCAGTATATGAAGATACATCTTCTTTGCCATCTGGTTTCAGAGTTTTGGCAACATTTCCTGATGTGCTGATGATACCAGATTTAGTTTTTGGAAGTCTTGTATGGATTTTGGTGGCTTCTTCAAGAGTGCCATTTCCCATTGTACAAGGATGGGTTATGTATGTCTCCGTATCCCTTTTTTTCTTCAGTGTGCTCCTCATGCTGCTGTATTGCGCTCGTGCACATGGAGGAAAGTCATCCTGGACAGCAGTTGATGCTTTTTATCACTGCGTTGCTGCTTACTTCTACTTGAGTGCCTCTGTCCTAGAAAGCTACAGCACCATTGCACTGAGTAATGTGACCATATATCAGCTTTATCAAGAGAATATTGCAGCTGTGGTGTTTGCCTATCTTGCCACACTTTCCTATACAATTCATGCTATTTTCTCACTGATACGGTGGAAAGGATCATCCTAA
Full Trace Sequence: cccgaccagaaacagcaggatttgggaggaagatcacaacctgtgcttttcctcagccttgagggaagaagagggaatagaccaatatatctaaatcaccagatctgcagtaattgacatggcagccacaactcctaatgccccagtatatgaagatacatcttctttgccatctggtttcagagttttggcaacatttcctgatgtgctgatgataccagatttagtttttggaagtcttgtatggattttggtggcttcttcaagagtgccatttcccattgtacaaggatgggttatgtatgtctccgtatccctttttttcttcagtgtgctcctcatgctgctgtattgcgctcgtgcacatggaggaaagtcatcctggacagcagttgatgctttttatcactgcgttgctgcttacttctacttgagtgcctctgtcctagaaagctacagcaccattgcactgagtaatgtgaccatatatcagctttatcaagagaatattgcagctgtggtgtttgcctatcttgccacactttcctatacaattcatgctattttctcactgatacggtggaaaggatcatcctaatactgaaacatgtggtaacgattcggagtcgcacaatctacttgaaataaaagctaaactacaatatggactggcagagacactagcaaaatacttgtcccatgtgtacgtactatgttaggaatatattcggatttagcatcagattgcacagatagttacacgcccgagcccctgcgccgatcaaagtgaacacatcactaaagataaatctaccaatgtcttcccttcagttacaaatgtttgtgtttttatttgtgttttataggtattttttcctgtaacagtttgagcaaatgtatttaatgttaatgtgtgtttacagtttacagaatgtgatttaatctcttatttgaattgtaaatatgcagccaaaaattagtcacatacaaatcaattttagagaacaaataataaaataaatgtaattttcacttaaagaaaaaaaaaaaaaaaa
Translation: MAATTPNAPVYEDTSSLPSGFRVLATFPDVLMIPDLVFGSLVWILVASSRVPFPIVQGWVMYVSVSLFFFSVLLMLLYCARAHGGKSSWTAVDAFYHCVAAYFYLSASVLESYSTIALSNVTIYQLYQENIAAVVFAYLATLSYTIHAIFSLIRWKGSS
Donor tissue: