ORFeome > map1lc3b – XORFeome 2.0

map1lc3b – XORFeome 2.0

General Information

Species: Xenopus tropicalis microtubule-associated protein 1 light chain 3 beta, mRNA (cDNA clone MGC:76283 IMAGE:5379376), complete cds
Gene Symbol: map1lc3b
Gene ID: 394972
ORF gb_acc: MG132878
ORF ID: 10239

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064267

Library Location

Plate ID: GDExt11002
Well Location: F09

EST Sequences

Clone: MGC:76283 IMAGE:5379376
Trimmed Sequence: ATGCCCTCTGAGAAGACATTTAAACAAAGAAGAAGCTTAGAGCAAAGAGTGGAAGACGTGAGACTCATCAGGGAACAACATCCAACAAAAATTCCAGTCATCATTGAGAGATACAAGGGAGAGAAGCAATTACCAGTCCTGGATAAAACCAAATTCCTGGTCCCTGATCACGTCAACATGAGTGAGCTTATTAAAATCATCAGGCGCCGCCTACAGCTCAACTCCAATCAGGCTTTCTTTCTGCTAGTAAATGGCCACAGCATGGTGAGCGTATCTACACCTATATCTGAGGTGTATGAACGGGAAAAGGATGAAGATGGCTTCCTTTACATGGTATACGCCTCACAGGAGACTTTTGGAGTGAAATACGCATAA
Full Trace Sequence: gagagatagaaggaagaaggaacggcacagaaacaaaaacagagacaagatgccctctgagaagacatttaaacaaagaagaagcttagagcaaagagtggaagacgtgagactcatcagggaacaacatccaacaaaaattccagtcatcattgagagatacaagggagagaagcaattaccagtcctggataaaaccaaattcctggtccctgatcacgtcaacatgagtgagcttattaaaatcatcaggcgccgcctacagctcaactccaatcaggctttctttctgctagtaaatggccacagcatggtgagcgtatctacacctatatctgaggtgtatgaacgggaaaaggatgaagatggcttcctttacatggtatacgcctcacaggagacttttggagtgaaatacgcataaaaggaaatcaactttttatttgtttttctttttaaacgtacggtggaatataacacaggctgctgaagcagatctttcccaaatccatattatatacacgccgcacataacattatttcattttcataaggcaaacattcagttccttgctttttctttgaagaattaaacctagtaacactggttctgtcatgtgatactgaagcttcatgtacaccaagaagttggtagtaacttacctatatgcctttaatatccattaccattgttcccatgtagcaatttaacgggtacagtggtattgtctaggaaatagcctctgctatggatgactgcaattcagctataaggaatatgtttttacactgatgtttctcacaccttcatatcatactgggaggattttgttttatgtcgctttgttatatgcagcagaaactaaatgacagcttataatgggagagaccattatatgaaaggggtgaaatgaaaggcccctggtttgccacaatggcgctgccaacttaatgtccttatacaaagatccacaattagatcccagtcccactattttaataataagagatggaaaataaaaactaaaaaagttgttgttacagtgagaaatacattaatatagatttccatagaatctaggcatatgctgctgcctgtaccgttggtgacaactttagaagcgatttcttgggatggtcagcatttctttttcagccatcggaatgcgacagtctgactgtggcttgggaacggggttccaggcaggagggccaatgcaacactccttaactgagatgcacatcattgtgctcctaaatgaaaagcaacatatattgttataatgtttctaatcagagagatttttctgtccttttgtgtgtaccattgtgattttgtagaacttgaactggcagagcaatgtgtacattagccatggagttcttttaataacaaggcattcatgtgtgtgcaggattatttttggagtacaactgaggatgtatgccatggggaggagcatagctacaaggtttgaaacaggtcacaaaataatttaacataaaaaattgaatatataaacacaggagggcaatagttttattggaataatttcataaccccatatgcaggagataaaatttataggtggatagagggcatggaattagaatctgtaggaccgtaaaccaaagtttacatggaggcccatgggcttttagatatgctgacagtctggctgaagataagattaatatatgatgtacattaaggggccgatttattaagttgtgtaaaatgtttgacaccaaaataatggtgtattaatttgtatgaaataataaaattgctatttatcaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MPSEKTFKQRRSLEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNSNQAFFLLVNGHSMVSVSTPISEVYEREKDEDGFLYMVYASQETFGVKYA
Donor tissue: tailbud